Peptide Schedule

Semaglutide

Weight LossInjectionFDA ApprovedGrade B~7 days half-life
GLP-1 AgonistWeight ManagementAppetite Regulation

Benefits

Proven 15-17% body weight loss in clinical trials
Suppresses appetite at the brain level
Improves blood sugar and insulin sensitivity
Reduces cardiovascular risk
Once-weekly dosing
Half-Life
~7 days
Route
Injection
Frequency
Weekly
Vial Sizes
5mg, 10mg
BAC Water
2mL
Safety Grade
Grade B
Open Semaglutide Dosage Calculator
Calculate exact syringe units for your vial and dose

About Semaglutide

Semaglutide is a GLP-1 receptor agonist — the same active ingredient in Ozempic and Wegovy. It mimics the hormone GLP-1, which regulates appetite and blood sugar. By slowing gastric emptying and acting on brain satiety centers, it dramatically reduces hunger and caloric intake. FDA-approved for both type 2 diabetes and obesity.

Who Should Consider Semaglutide

  • Adults with BMI ≥30 (or ≥27 with weight-related comorbidity)
  • Type 2 diabetics needing glycemic control
  • Individuals at elevated cardiovascular risk
  • Adults seeking long-term appetite suppression
  • Patients with obesity-related comorbidities (hypertension, dyslipidemia, sleep apnea)

How Semaglutide Works

Semaglutide mimics the incretin hormone GLP-1, binding to GLP-1 receptors in the pancreas (enhancing insulin secretion), the gut (slowing gastric emptying), and the brain (activating satiety centers in the hypothalamus). This multi-site action reduces appetite, decreases caloric intake, and improves glycemic control. Its albumin-binding fatty acid side chain extends its half-life to ~7 days.

What to Expect

Weeks 1-4
0.25mg

Titration phase. Mild appetite reduction begins. GI side effects (nausea) most common early. Body adjusts to GLP-1 activation.

Weeks 5-8
0.5mg

Appetite suppression becomes noticeable. Early weight loss of 2-4%. Nausea typically subsides as dose stabilizes.

Weeks 9-16
1.0-1.7mg

Significant hunger reduction and steady weight loss. Blood sugar and insulin sensitivity improve. Most patients lose 5-10% body weight.

Weeks 17-68
2.4mg maintenance

Full therapeutic dose. Clinical trials show 15-17% average weight loss by week 68. Cardiovascular markers improve. Weight loss rate slows as new equilibrium is reached.

Week 68+

Long-term maintenance. Weight stability at reduced level while on therapy. Continued cardiovascular and metabolic benefits. Weight regain common if discontinued.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner250mcgWeekly
Moderate500mcgWeekly
Aggressive1mgWeekly

Note: Titrate slowly over 4-week intervals to manage GI side effects. Start at 250mcg/week and increase by 250mcg every 4 weeks. Do not exceed 2400mcg/week.

How to Inject Semaglutide

Inject subcutaneously once weekly, same day each week. Abdomen, thigh, or upper arm. Rotate sites. Can be taken with or without food, but some find fasted injection reduces nausea.

Cycling Protocol

On Period
52 weeks
Off Period
0 weeks

Semaglutide is typically used long-term. Weight regain commonly occurs after discontinuation. Discuss with your provider before stopping.

Pharmacokinetics

Half-Life
168h
Bioavailability
SC: ~89%
Tmax
1-3 days
Data Confidence
high

Source: FDA Prescribing Information (Ozempic/Wegovy), Section 12.3

Pharmacokinetics — Active Dose Over Time

t½ = ~7 days
50%25%12.5%100%75%50%25%0%07d14d21d28d35dTime after injectionDose remaining
After 1 half-life (7d): 50% remainsAfter 2 half-lives (14d): 25% remainsAfter 3 half-lives (21d): 12.5% remains
At a 500mcg dose: 50% = 250mcg remaining after 7d. Recommended frequency: Weekly.

Disclaimer: This curve is a simplified first-order exponential decay model. Actual pharmacokinetics vary based on injection site, individual metabolism, body composition, and other factors. Half-life values are approximate and based on available preclinical and clinical literature. Many research peptides lack formal human pharmacokinetic studies. This is for educational purposes only — not medical advice.

Side Effects

BLACK BOX WARNING: Semaglutide causes thyroid C-cell tumors in rodents. It's unknown whether it causes thyroid C-cell tumors, including medullary thyroid carcinoma (MTC), in humans. Contraindicated in patients with a personal or family history of MTC or MEN2. Common side effects: nausea, vomiting, diarrhea, constipation (usually subside with slow titration). Rare: pancreatitis, gallbladder disease, acute kidney injury from dehydration.

Contraindications

  • Personal or family history of medullary thyroid carcinoma (MTC)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN2)
  • History of pancreatitis
  • Pregnancy or breastfeeding
  • Known hypersensitivity to semaglutide or any excipients
  • Severe gastrointestinal disease (e.g., gastroparesis)

Drug Interactions

  • Insulin and sulfonylureas — increased hypoglycemia risk, dose reduction often needed
  • Oral medications may have delayed absorption due to slowed gastric emptying
  • Levothyroxine — monitor thyroid levels, exposure may be altered
  • Warfarin — monitor INR more frequently during initiation
  • Oral contraceptives — consider delayed absorption; no clinically significant interaction observed in studies but caution advised

Storage & Stability

Before Reconstitution
Refrigerate at 2-8°C, stable up to 2 years
After Reconstitution
Refrigerate at 2-8°C, use within 6 weeks
Temperature
2-8°C (36-46°F)

Molecular Profile

Amino Acids
30
Molecular Weight
4,113.58 Da
Sequence
HEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
HydrophobicPolarPositiveNegativeSpecial

Related Peptides

References

  1. STEP 1: Once-Weekly Semaglutide in Adults with Overweight or Obesity (NEJM)PubMed 33567185
  2. STEP 3: Semaglutide + Intensive Behavioral Therapy (JAMA)PubMed 33625476
  3. SUSTAIN 6: Cardiovascular Outcomes with Semaglutide in Type 2 Diabetes (NEJM)PubMed 27633186
  4. Wegovy (Semaglutide 2.4mg) FDA Prescribing InformationFDA Label
  5. Ozempic (Semaglutide) FDA Prescribing InformationFDA Label
  6. Clinical Pharmacokinetics of Semaglutide: A Systematic ReviewPubMed

Related Resources

Frequently Asked Questions