Peptide Schedule
Cagrilintide37 residuesKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTYEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Cagrilintide

Weight LossInjectionPhase 3Grade B~7 days half-life
Amylin AnalogWeight ManagementAppetite SuppressionCagriSemaWeekly Injection

Benefits

Different mechanism than GLP-1 — targets amylin pathway
Reduces cravings and appetite
Slows gastric emptying for prolonged fullness
Weekly dosing for convenience
Synergistic when combined with semaglutide
Half-Life
~7 days
Route
Injection
Frequency
Weekly
Vial Sizes
5mg
BAC Water
2mL
Safety Grade
Grade B
Open Cagrilintide Dosage Calculator
Calculate exact syringe units for your vial and dose

About Cagrilintide

Cagrilintide is a long-acting amylin receptor agonist that works through a completely different pathway than GLP-1 drugs like semaglutide. Amylin is naturally released by the pancreas after meals to promote satiety. Cagrilintide mimics this effect, reducing cravings and slowing gastric emptying. It's being studied both alone and in combination with semaglutide (CagriSema) for enhanced weight loss.

Who Should Consider Cagrilintide

  • Adults with BMI ≥30 (or ≥27 with weight-related comorbidity)
  • Individuals who have plateaued on GLP-1 therapy alone
  • Adults seeking a non-GLP-1 weight loss mechanism
  • Patients being considered for CagriSema combination therapy
  • Adults with obesity and type 2 diabetes

How Cagrilintide Works

Cagrilintide is a long-acting acylated amylin analog that binds to amylin receptors (AMY1, AMY2, AMY3) and calcitonin receptors in the area postrema and hypothalamus. Activation of these receptors promotes satiety signaling, slows gastric emptying, and suppresses postprandial glucagon secretion. Unlike GLP-1 agonists, cagrilintide works through a distinct neuroendocrine pathway, which is why the combination with semaglutide (CagriSema) produces additive weight loss beyond either agent alone.

What to Expect

Weeks 1-4
0.25-0.5mg

Titration phase. Mild appetite reduction may begin. Nausea is most common during this period. Body adapts to amylin receptor activation.

Weeks 5-12
0.5-1.2mg

Appetite suppression becomes noticeable. Early weight loss of 2-4%. GI side effects typically decrease as the body adjusts to dose escalation.

Weeks 13-26
1.2-2.4mg

Steady weight loss continues. Phase 2 data showed ~6-9% body weight reduction at moderate doses by this point. Cravings and portion sizes decrease.

Weeks 27-52
2.4mg maintenance

Full therapeutic dose. Monotherapy trials showed ~10.8% mean weight loss at 2.4mg. Metabolic markers improve. Weight loss rate stabilizes.

Weeks 52+
maintenance

Continued maintenance of weight loss. In the REDEFINE 1 trial, cagrilintide monotherapy achieved ~11.8% weight loss at 68 weeks. Ongoing treatment is needed to sustain results.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner500mcgWeekly
Moderate1,200mcgWeekly
Aggressive2,400mcgWeekly

Note: Long-acting amylin analog. Different mechanism than GLP-1 agonists. Titrate slowly from 0.5mg. Can be combined with semaglutide (CagriSema).

How to Inject Cagrilintide

Inject subcutaneously once weekly in the abdomen, thigh, or upper arm. Rotate injection sites. Follow a slow titration schedule starting at 0.25-0.5mg and escalating every 4 weeks to minimize GI side effects. If combining with semaglutide, inject at separate sites.

Cycling Protocol

On Period
16 weeks
Off Period
0 weeks

Designed as continuous therapy. No cycling needed due to sustained amylin receptor responsiveness. Discontinuation leads to weight regain, so ongoing use is expected.

Pharmacokinetics

Half-Life
175h
Bioavailability
SC: not yet formally reported
Tmax
24-72 hours
Data Confidence
moderate

Source: Phase 1b PK study (Enebo et al. Lancet 2021, PMID 33894838); t½ 159-195h (~7.3 days)

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Nausea, diarrhea, and injection site reactions. GI side effects typically decrease over time with slow titration.

Contraindications

  • Pregnancy or breastfeeding — safety not established
  • Known hypersensitivity to cagrilintide or any excipients
  • Gastroparesis or severe gastrointestinal motility disorders
  • Personal or family history of medullary thyroid carcinoma (MTC)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN2)
  • Planned surgery — discontinue at least 20-24 days before elective procedures

Drug Interactions

  • Insulin and sulfonylureas — increased hypoglycemia risk due to combined glucose-lowering effects
  • Oral medications may have delayed absorption due to slowed gastric emptying
  • Oral contraceptives — monitor efficacy as absorption timing may be altered
  • Acetaminophen and other oral analgesics — delayed onset of action possible
  • Semaglutide — no pharmacokinetic interaction observed; additive GI side effects possible

Storage & Stability

Before Reconstitution
Refrigerate at 2-8°C, protect from light
After Reconstitution
Refrigerate at 2-8°C, use within 4 weeks
Temperature
2-8°C (36-46°F)

Molecular Profile

Amino Acids
37
Molecular Weight
4,409 Da
Sequence
KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTY
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Once-weekly cagrilintide for weight management in people with overweight and obesity — Phase 2 Trial (Lancet 2021)PubMed 34798060
  2. Development of Cagrilintide, a Long-Acting Amylin Analogue (J Med Chem 2021)PubMed 34288673
  3. Safety, tolerability, pharmacokinetics, and pharmacodynamics of cagrilintide with semaglutide — Phase 1b Trial (Lancet 2021)PubMed 33894838
  4. Cagrilintide 2.4mg with semaglutide 2.4mg in type 2 diabetes — Phase 2 Trial (Lancet 2023)PubMed 37364590
  5. Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity — REDEFINE 1 (NEJM 2025)PubMed 40544433
  6. Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes — REDEFINE 2 (NEJM 2025)PubMed 40544432
  7. Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity — Review (2023)PubMed 36883831

Frequently Asked Questions