Peptide Schedule

Tirzepatide

Weight LossInjectionFDA ApprovedGrade A~5 days half-life
GLP-1 AgonistWeight ManagementAppetite RegulationBlood Sugar Control

Benefits

Greater weight loss than semaglutide in trials
Dual hormone targeting (GIP + GLP-1)
Controls blood sugar and appetite simultaneously
Once-weekly dosing
Reduces cardiovascular risk factors
Half-Life
~5 days
Route
Injection
Frequency
Weekly
Vial Sizes
5mg, 10mg, 15mg
BAC Water
2mL
Safety Grade
Grade A
Open Tirzepatide Dosage Calculator
Calculate exact syringe units for your vial and dose

About Tirzepatide

Tirzepatide is a dual GIP/GLP-1 receptor agonist, sold as Mounjaro (diabetes) and Zepbound (obesity). It targets two incretin hormones simultaneously, producing greater weight loss than semaglutide in head-to-head trials (up to 22.5% vs 15%). GIP activation enhances fat metabolism and may improve tolerability compared to GLP-1-only drugs.

Who Should Consider Tirzepatide

  • Adults with BMI ≥30 (or ≥27 with weight-related comorbidity)
  • Type 2 diabetics needing superior glycemic control
  • Patients who plateaued on semaglutide or liraglutide
  • Those seeking the most potent FDA-approved weight-loss injectable
  • Adults with obesity-related cardiovascular risk factors

How Tirzepatide Works

Tirzepatide activates both GIP and GLP-1 receptors. GLP-1 receptor activation suppresses appetite, slows gastric emptying, and enhances insulin secretion. GIP receptor activation improves fat metabolism, enhances insulin sensitivity, and may reduce nausea compared to GLP-1-only agonists. The dual mechanism produces superior weight loss and glycemic control.

What to Expect

Weeks 1-4

Starting dose 2.5mg weekly. Appetite suppression begins within days. Nausea is most common but usually mild. Minimal weight loss expected — this is a tolerability phase.

Weeks 5-8

Dose escalated to 5mg. Noticeable hunger reduction. Early weight loss of 2-4% body weight. GI side effects typically improving.

Weeks 9-12

Dose escalated to 7.5mg. Steady weight loss continues. Blood sugar improvements measurable on labs.

Weeks 13-16

Dose escalated to 10mg. Significant appetite changes. Cumulative weight loss approaching 8-10%.

Weeks 17-20

Dose escalated to 12.5mg, then 15mg if tolerated. Maximum efficacy phase begins. SURMOUNT-1 showed 22.5% weight loss at 72 weeks on 15mg.

Weeks 21-72

Maintenance at maximum tolerated dose (5-15mg). Weight loss continues to plateau around 20-25%. Cardiovascular and metabolic markers significantly improved.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner2,500mcgWeekly
Moderate5mgWeekly
Aggressive10mgWeekly

Note: Dual GIP/GLP-1 agonist (Mounjaro/Zepbound). Titrate from 2.5mg. More potent weight loss than semaglutide in trials.

How to Inject Tirzepatide

Inject subcutaneously once weekly into abdomen, thigh, or upper arm. Rotate sites. Titrate slowly — increase dose every 4 weeks to minimize GI side effects.

Cycling Protocol

On Period
52 weeks
Off Period
0 weeks

Intended for long-term use. Weight regain expected upon discontinuation. Maintenance dosing may be lower than escalation dose.

Pharmacokinetics

Half-Life
120h
Bioavailability
SC: ~80%
Tmax
8-72 hours
Data Confidence
high

Source: Mounjaro FDA Label, Section 12.3; confirmed by PopPK analysis (t½ ~117h)

Pharmacokinetics — Active Dose Over Time

t½ = ~5 days
50%25%12.5%100%75%50%25%0%05d10d15d20d25dTime after injectionDose remaining
After 1 half-life (5d): 50% remainsAfter 2 half-lives (10d): 25% remainsAfter 3 half-lives (15d): 12.5% remains
At a 5mg dose: 50% = 2.5mg remaining after 5d. Recommended frequency: Weekly.

Disclaimer: This curve is a simplified first-order exponential decay model. Actual pharmacokinetics vary based on injection site, individual metabolism, body composition, and other factors. Half-life values are approximate and based on available preclinical and clinical literature. Many research peptides lack formal human pharmacokinetic studies. This is for educational purposes only — not medical advice.

Side Effects

BLACK BOX WARNING: Tirzepatide causes thyroid C-cell tumors in rodents. It's unknown whether it causes thyroid C-cell tumors, including medullary thyroid carcinoma (MTC), in humans. Contraindicated in patients with a personal or family history of MTC or MEN2. Common side effects: nausea (12-18%), diarrhea (12-17%), decreased appetite, vomiting, constipation. GI effects are usually mild-to-moderate and improve with slow dose titration. Rare: pancreatitis, gallbladder disease, hypersensitivity reactions.

Contraindications

  • Personal or family history of medullary thyroid carcinoma (MTC)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN2)
  • History of pancreatitis or active pancreatitis
  • Pregnancy or planning to become pregnant (stop at least 2 months before conception)
  • Breastfeeding
  • Known hypersensitivity to tirzepatide or any excipients
  • Severe gastrointestinal disease (e.g., gastroparesis)

Drug Interactions

  • Insulin and sulfonylureas — increased hypoglycemia risk; dose reduction often needed
  • Oral contraceptives — reduced efficacy due to delayed gastric emptying; use barrier method for 4 weeks after initiation and each dose escalation
  • Oral medications with narrow therapeutic index (e.g., warfarin) — monitor closely due to delayed gastric emptying
  • Other GLP-1 receptor agonists (semaglutide, liraglutide) — do not combine; overlapping mechanism
  • Oral medications requiring threshold concentrations — absorption timing may shift; monitor efficacy

Storage & Stability

Before Reconstitution
Refrigerate at 2-8°C
After Reconstitution
Refrigerate at 2-8°C, use within 4 weeks
Temperature
2-8°C (36-46°F)

Molecular Profile

Amino Acids
37
Molecular Weight
4,813.45 Da
Sequence
YEGTFTSDYSILDKIAQKAFVQWLIAGGPSSGAPPPS
HydrophobicPolarPositiveNegativeSpecial

Related Peptides

References

  1. SURMOUNT-1 — Tirzepatide Once Weekly for the Treatment of ObesityPubMed 35658024
  2. SURPASS-1 — Tirzepatide vs Placebo in Type 2 DiabetesPubMed 34170647
  3. SURPASS-2 — Tirzepatide vs Semaglutide in Type 2 DiabetesPubMed 34170646
  4. Mounjaro (Tirzepatide) FDA Prescribing InformationFDA Label
  5. Zepbound (Tirzepatide) FDA Prescribing InformationFDA Label
  6. Population Pharmacokinetics of TirzepatidePubMed

Related Resources

Frequently Asked Questions