Peptide Schedule
Orexin (Hypocretin)33 residuesQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTMEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Orexin (Hypocretin)

SleepInjection/NasalResearchGrade C~30 minutes (Orexin-A); ~5 minutes (Orexin-B) half-life
SleepWakefulnessNarcolepsyNeuropeptideHypothalamusCircadianAppetite4 weeks on / 2 weeks off

Benefits

Promotes sustained wakefulness and arousal
Enhances cognitive performance under sleep deprivation
Regulates appetite and energy homeostasis
Stabilizes sleep-wake transitions and prevents fragmented sleep
Modulates reward circuitry and motivation
Supports autonomic cardiovascular regulation
Potential therapeutic target for narcolepsy type 1
Half-Life
~30 minutes
Route
Injection / Nasal
Frequency
Daily
Vial Sizes
0.5mg, 1mg
BAC Water
2mL
Safety Grade
Grade C
Open Orexin (Hypocretin) Dosage Calculator
Calculate exact syringe units for your vial and dose

About Orexin (Hypocretin)

Orexin-A and Orexin-B, also known as Hypocretin-1 and Hypocretin-2, are excitatory neuropeptides synthesized by a discrete population of neurons in the lateral and perifornical hypothalamus. Their discovery in 1998 by both the Sakurai and de Lecea laboratories represented a watershed moment in sleep neuroscience, linking a single neuropeptide system to the regulation of wakefulness, feeding behavior, autonomic tone, and reward processing. Orexin-A is a 33-amino-acid peptide stabilized by two intramolecular disulfide bonds and an N-terminal pyroglutamyl modification, conferring relatively high stability and the ability to cross the blood-brain barrier in small quantities. Orexin-B is a 28-amino-acid linear peptide that is less stable and does not cross the blood-brain barrier as readily. Both peptides are derived from a common 131-amino-acid precursor, prepro-orexin, through proteolytic cleavage. These neuropeptides bind to two G-protein-coupled receptors: OX1R, which has a ten-fold selectivity for Orexin-A over Orexin-B, and OX2R, which binds both peptides with similar affinity. OX2R is considered the primary mediator of wake-promoting effects, while OX1R plays a larger role in reward and autonomic regulation. Dual orexin receptor antagonists (DORAs) such as suvorexant and lemborexant are FDA-approved for the treatment of insomnia, validating the orexin system as a major therapeutic target. The loss of orexin-producing neurons, likely through an autoimmune mechanism, causes narcolepsy type 1, a condition characterized by excessive daytime sleepiness and cataplexy. Cerebrospinal fluid orexin-A levels below 110 pg/mL are a diagnostic biomarker for this disorder. Research into orexin-A agonists and replacement therapies aims to restore wakefulness in narcoleptic patients. Animal studies have demonstrated that intranasal delivery of Orexin-A can enhance alertness and cognitive performance in sleep-deprived primates, though no orexin agonist peptide has yet reached clinical trials in humans.

Who Should Consider Orexin (Hypocretin)

  • Researchers studying narcolepsy and sleep disorders
  • Neuroscientists investigating arousal and wake circuits
  • Individuals with excessive daytime sleepiness (research context)
  • Investigators exploring appetite and metabolic regulation
  • Preclinical researchers studying reward and addiction pathways

How Orexin (Hypocretin) Works

Orexin-A and Orexin-B exert their effects by binding to two G-protein-coupled receptors, orexin receptor type 1 (OX1R) and orexin receptor type 2 (OX2R). OX1R couples primarily to Gq proteins, activating phospholipase C and triggering intracellular calcium release via inositol trisphosphate (IP3) signaling. OX2R couples to both Gq and Gi/Go pathways, providing a more nuanced modulatory output. Activation of these receptors depolarizes target neurons, increasing their firing rate and neurotransmitter release. The orexin system serves as a master stabilizer of the sleep-wake switch described by the flip-flop model. Orexin neurons receive integrative inputs from the circadian clock (suprachiasmatic nucleus), homeostatic sleep drive signals (adenosine accumulation), and metabolic status indicators (leptin, ghrelin, glucose). They project to and excite all major arousal centers, including the locus coeruleus (norepinephrine), tuberomammillary nucleus (histamine), dorsal raphe (serotonin), ventral tegmental area (dopamine), and basal forebrain (acetylcholine). This widespread excitatory drive consolidates wakefulness and prevents inappropriate transitions into sleep. Beyond arousal, orexin signaling modulates feeding behavior through direct projections to the arcuate nucleus and lateral hypothalamic melanin-concentrating hormone neurons. The reward-related effects are mediated via OX1R-dense projections to the ventral tegmental area, where orexin potentiates dopaminergic signaling. Autonomic effects include sympathoexcitation via projections to the rostral ventrolateral medulla and intermediolateral cell column of the spinal cord.

What to Expect

Week 1

Baseline assessment; initial tolerability evaluation in research protocols

Weeks 2-3

Observable changes in wakefulness duration and sleep-wake consolidation in animal models

Weeks 3-4

Peak effects on alertness, locomotor activity, and feeding behavior noted in preclinical studies

Weeks 4-6

Assessment of sustained efficacy and potential receptor desensitization; cycling off-period may begin

Dosing Protocol

LevelDose / InjectionFrequency
Beginner10mcgDaily
Moderate30mcgDaily
Aggressive50mcg2x Daily

Note: Orexin-A (Hypocretin-1) and Orexin-B (Hypocretin-2) are hypothalamic neuropeptides that regulate wakefulness, appetite, and reward-driven behavior. Discovered independently by two groups in 1998, they are produced by a small cluster of approximately 70,000 neurons in the lateral hypothalamus that project widely throughout the brain and spinal cord. Orexin-A is a 33-amino-acid peptide with two disulfide bonds, making it more stable than the 28-amino-acid Orexin-B. Loss of orexin-producing neurons is the hallmark pathology of narcolepsy type 1 (with cataplexy). These peptides act on two G-protein-coupled receptors, OX1R and OX2R. Current research use focuses on intranasal and intracerebroventricular delivery in animal models. The native peptides remain strictly research-only and are not approved for human therapeutic use.

How to Inject Orexin (Hypocretin)

Orexin peptides are supplied as lyophilized powder and should be reconstituted with bacteriostatic water. Inject the bacteriostatic water slowly down the side of the vial and gently swirl without shaking to avoid degradation. For research protocols, subcutaneous injection in the abdominal area is the most common route, administered in the morning to align with physiological wake-promoting activity. Intranasal delivery has been explored in primate studies and may offer improved central nervous system bioavailability compared to subcutaneous injection. Store reconstituted solution at 2-8°C and use within 14 days. Avoid repeated freeze-thaw cycles. Rotate injection sites to minimize local irritation. Because Orexin-B degrades rapidly, Orexin-A is generally preferred for research applications requiring peripheral administration.

Cycling Protocol

On Period
4 weeks
Off Period
2 weeks

Cycling recommendations are extrapolated from general neuropeptide research protocols. Due to receptor desensitization potential at OX1R and OX2R, periodic off-periods are advisable. No human clinical cycling data exists for the native peptides.

Pharmacokinetics

Half-Life
30min
Bioavailability
SC: limited CNS penetration; Intranasal: improved CNS delivery demonstrated in primates
Tmax
~15-30 minutes (intranasal, primate data)
Data Confidence
low

Source: Kastin AJ, Akerstrom V. Orexin A but not orexin B rapidly enters brain from blood by simple diffusion. J Pharmacol Exp Ther. 1999;289(1):219-223. PMID: 10087007

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Research with exogenous orexin peptides is largely limited to animal models, so the human side-effect profile of the native peptides is not well-characterized from clinical trials. In preclinical studies, intranasal Orexin-A at higher doses has been associated with increased locomotor activity, elevated heart rate, and transient increases in blood pressure, consistent with the known role of orexin in sympathetic activation. Appetite stimulation is a predictable pharmacological effect and could be undesirable for some individuals. Central administration in rodents at supraphysiological doses has produced anxiety-like behavior and stress-axis activation, including increased corticotropin-releasing hormone signaling. Because orexin neurons interact extensively with monoaminergic, cholinergic, and histaminergic arousal systems, there is theoretical concern for excessive wakefulness or insomnia if dosing is mistimed. Local injection-site irritation with subcutaneous delivery has been reported in animal models.

Contraindications

  • Known hypersensitivity to orexin peptides or excipients
  • Uncontrolled hypertension due to sympathoexcitatory effects
  • Severe anxiety disorders (orexin may exacerbate HPA axis activation)
  • Concurrent use of orexin receptor antagonists (suvorexant, lemborexant)
  • Pregnancy or breastfeeding (no safety data available)

Drug Interactions

  • Suvorexant and lemborexant (dual orexin receptor antagonists — pharmacological opposition)
  • Stimulants such as modafinil or amphetamines (additive arousal effects)
  • Sedative-hypnotics and benzodiazepines (opposing pharmacological effects)
  • Beta-blockers (may attenuate orexin-mediated cardiovascular responses)
  • CRH receptor antagonists (potential interaction via stress-axis modulation)

Storage & Stability

Before Reconstitution
Up to 24 months at -20°C
After Reconstitution
Use within 14 days when stored at 2-8°C
Temperature
-20°C for long-term; 2-8°C after reconstitution

Molecular Profile

Amino Acids
33
Sequence
QPLPDCCRQKTCSCRLYELLHGAGNHAAGILTM
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Orexins and orexin receptors: a family of hypothalamic neuropeptides and G protein-coupled receptors that regulate feeding behaviorPubMed 9491897
  2. The hypocretins: hypothalamus-specific peptides with neuroexcitatory activityPubMed 9464994
  3. Narcolepsy in orexin knockout mice: molecular genetics of sleep regulationPubMed 10458611
  4. Nasal administration of orexin-A (hypocretin-1) reverses the sleep-deprivation deficit in non-human primatesPubMed 18077435
  5. Suvorexant in patients with insomnia: results from two 3-month randomized controlled clinical trialsPubMed 25117004

Frequently Asked Questions