Peptide Schedule
Neuropeptide Y (NPY)36 residuesYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Neuropeptide Y (NPY)

MetabolicInjectionResearchGrade C~20-30 minutes (plasma) half-life
Appetite StimulationOrexigenicStress ResilienceAnxiolyticNeuropeptideVasoconstrictionCircadian Rhythm4 weeks on / 4 weeks off

Benefits

Potent appetite and food intake stimulation via hypothalamic Y1/Y5 receptors
Anxiolytic effects and enhanced stress resilience in preclinical models
Modulation of sympathetic nervous system activity and cardiovascular tone
Regulation of circadian rhythm and sleep-wake cycles
Promotion of bone formation through osteoblast signaling pathways
Neuroprotective properties under ischemic and excitotoxic conditions
Modulation of immune cell activity and inflammatory responses
Half-Life
~20-30 minutes
Route
Injection
Frequency
Daily
Vial Sizes
1mg, 2mg, 5mg
BAC Water
2mL
Safety Grade
Grade C
Open Neuropeptide Y (NPY) Dosage Calculator
Calculate exact syringe units for your vial and dose

About Neuropeptide Y (NPY)

Neuropeptide Y (NPY) is a highly conserved 36-amino-acid peptide belonging to the pancreatic polypeptide family, which also includes peptide YY (PYY) and pancreatic polypeptide (PP). First isolated from porcine brain in 1982 by Tatemoto and colleagues, NPY is one of the most abundant and widely distributed neuropeptides in both the central and peripheral nervous systems. It is synthesized primarily in the arcuate nucleus of the hypothalamus, the brainstem, and sympathetic neurons throughout the body. NPY exerts its biological effects through five known G-protein-coupled receptor subtypes: Y1, Y2, Y4, Y5, and the less characterized Y6. The Y1 and Y5 receptors are most closely associated with orexigenic (appetite-stimulating) signaling, while Y2 receptors function as presynaptic autoreceptors that modulate NPY release. The Y4 receptor preferentially binds pancreatic polypeptide but retains affinity for NPY. This receptor diversity allows NPY to participate in a remarkably broad range of physiological processes. In the hypothalamus, NPY is the most potent known stimulator of food intake. Central administration of NPY in rodent models triggers immediate and dose-dependent feeding, and chronic infusion produces sustained hyperphagia, weight gain, and metabolic shifts toward lipogenesis. NPY levels rise during fasting and caloric restriction, acting as a key hunger signal that integrates energy homeostasis with behavioral output. Beyond metabolism, NPY plays critical roles in the stress response. It is co-released with norepinephrine from sympathetic nerve terminals and acts as an anxiolytic agent in the amygdala and hippocampus. High NPY levels are associated with stress resilience, and studies in military personnel have correlated elevated plasma NPY with improved performance under extreme stress. NPY also contributes to cardiovascular regulation through potent vasoconstriction, modulates circadian rhythms via the suprachiasmatic nucleus, and influences bone remodeling through Y1 and Y2 receptor signaling in osteoblasts. As an exogenous research compound, NPY remains investigational with no approved therapeutic indications.

Who Should Consider Neuropeptide Y (NPY)

  • Researchers studying appetite regulation and energy homeostasis
  • Neuroscience investigators examining stress resilience and anxiety pathways
  • Cardiovascular researchers exploring sympathetic vasoconstriction mechanisms
  • Endocrinologists studying hypothalamic peptide signaling networks
  • Bone biology researchers investigating Y-receptor-mediated osteogenesis

How Neuropeptide Y (NPY) Works

Neuropeptide Y signals through a family of five G-protein-coupled receptors (Y1, Y2, Y4, Y5, and Y6) that couple primarily to inhibitory Gi/Go proteins. Activation of these receptors suppresses adenylyl cyclase activity, reducing intracellular cyclic AMP levels, and modulates calcium and potassium channel conductance to alter neuronal excitability. In the arcuate nucleus of the hypothalamus, NPY neurons are activated by low leptin and high ghrelin levels during energy deficit. Released NPY binds Y1 and Y5 receptors on downstream neurons in the paraventricular nucleus, stimulating orexigenic pathways that drive feeding behavior while simultaneously inhibiting anorexigenic POMC/CART neurons via Y1-mediated GABA release. The Y2 receptor functions as a presynaptic autoreceptor on NPY-expressing terminals, providing negative feedback to limit further NPY release. In the amygdala, NPY exerts anxiolytic effects primarily through Y1 receptor activation, which dampens CRF (corticotropin-releasing factor) signaling and reduces amygdalar excitability. Peripherally, NPY is co-stored and co-released with norepinephrine from sympathetic nerve terminals, potentiating norepinephrine-mediated vasoconstriction through postjunctional Y1 receptors on vascular smooth muscle. In bone tissue, Y2 receptor signaling in the hypothalamus modulates sympathetic output to osteoblasts, while local Y1 receptor activation on osteoblasts directly promotes bone formation.

What to Expect

Acute
0-30 minutes

Rapid onset of orexigenic signaling following central administration in animal models; peripheral vasoconstrictor effects observed within minutes

Short-term
1-7 days

Sustained hyperphagia and increased caloric intake with repeated central dosing; measurable changes in anxiety-related behavior in rodent models

2-4 weeks

Chronic central infusion produces significant weight gain, increased adiposity, and metabolic shifts toward lipogenesis in animal studies

4-8 weeks

Potential tachyphylaxis to orexigenic effects; receptor desensitization may attenuate feeding response; bone density changes detectable in long-term Y2 receptor studies

Dosing Protocol

LevelDose / InjectionFrequency
Beginner50mcgDaily
Moderate100mcgDaily
Aggressive200mcg2x Daily

Note: Neuropeptide Y is a 36-amino-acid peptide and one of the most abundant neuropeptides in the mammalian central and peripheral nervous systems. It acts through a family of G-protein-coupled receptors designated Y1 through Y5, each mediating distinct physiological effects. NPY is the most potent orexigenic (appetite-stimulating) peptide identified in the brain, with intracerebroventricular administration producing marked feeding behavior in animal models. Beyond appetite regulation, NPY modulates stress and anxiety responses, vasoconstriction, circadian rhythm entrainment, bone homeostasis, and immune function. Research use requires careful handling due to its short plasma half-life and the complexity of its receptor subtypes. Exogenous NPY administration remains strictly investigational, and all work should be conducted under appropriate research protocols with institutional oversight.

How to Inject Neuropeptide Y (NPY)

Neuropeptide Y is supplied as a lyophilized powder and should be reconstituted with bacteriostatic water using standard sterile technique. Gently swirl the vial rather than shaking to avoid degradation of the peptide. Allow the solution to reach room temperature before injection. Subcutaneous injection into the abdominal area or upper thigh is the typical peripheral administration route in research settings. Use an insulin syringe (29-31 gauge) to minimize injection site discomfort. Administer on an empty stomach or 30 minutes before a meal if appetite-related outcomes are being studied. Rotate injection sites to avoid lipodystrophy. Store reconstituted peptide at 2-8°C and use within 14 days. NPY is sensitive to proteolytic degradation, so minimize the number of needle punctures through the vial stopper. Document each dose, timing, and injection site for accurate research records.

Cycling Protocol

On Period
4 weeks
Off Period
4 weeks

Cycling is recommended due to potential receptor desensitization with chronic Y1/Y5 activation. Rodent studies show tachyphylaxis to orexigenic effects after sustained central infusion. Off-periods allow receptor resensitization. Protocols are extrapolated from animal data; no established human cycling guidelines exist.

Pharmacokinetics

Half-Life
25min
Bioavailability
SC: ~30-50% (estimated; significant first-pass proteolytic degradation)
Tmax
15-30 minutes (SC administration)
Data Confidence
moderate

Source: Plasma elimination studies; NPY has a half-life of approximately 20-25 minutes in circulation due to rapid enzymatic degradation by dipeptidyl peptidase IV (DPP-IV) and other peptidases

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

In preclinical research settings, exogenous NPY administration is associated with several dose-dependent effects that must be considered. The most prominent effect is hyperphagia, which, when sustained through chronic central infusion, leads to significant weight gain, increased adiposity, and metabolic shifts favoring fat storage. Peripheral NPY administration can produce vasoconstriction and elevations in blood pressure due to its potent effects on vascular smooth muscle via Y1 receptors. Alterations in heart rate and cardiac output have been observed at higher doses. Central administration may produce sedation, reduced locomotor activity, and changes in anxiety-related behaviors that vary depending on the brain region targeted and receptor subtype engaged. Hypothermia has been reported in some rodent studies following intracerebroventricular injection. Because NPY modulates multiple neurotransmitter systems including GABA, glutamate, and norepinephrine, off-target neurological effects are possible at supratherapeutic concentrations. Gastrointestinal effects including delayed gastric emptying and altered intestinal motility have been documented in animal models.

Contraindications

  • Uncontrolled hypertension or cardiovascular disease due to vasoconstrictor effects
  • Obesity or metabolic syndrome where appetite stimulation is contraindicated
  • Active eating disorders where orexigenic signaling could be harmful
  • Pregnancy or breastfeeding due to lack of safety data
  • Known hypersensitivity to NPY or any excipients in the formulation

Drug Interactions

  • Sympathomimetic agents (additive vasoconstrictor and hypertensive effects)
  • Beta-blockers and antihypertensives (NPY-mediated vasoconstriction may oppose therapeutic effects)
  • Anxiolytic medications including benzodiazepines (potential additive sedation with central NPY effects)
  • Leptin or leptin analogs (antagonistic effects on appetite regulation pathways)
  • GLP-1 receptor agonists (opposing effects on food intake and energy balance)

Storage & Stability

Before Reconstitution
Up to 24 months at -20°C, desiccated and protected from light
After Reconstitution
Use within 14 days when stored at 2-8°C; avoid repeated freeze-thaw cycles
Temperature
-20°C for long-term storage; 2-8°C after reconstitution

Molecular Profile

Amino Acids
36
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Neuropeptide Y and its role in CNS disease and repairReview
  2. Neuropeptide Y: a stressful reviewReview
  3. The role of neuropeptide Y in cardiovascular regulationPubMed 9353615
  4. Neuropeptide Y acts directly in the periphery on fat tissue and mediates stress-induced obesity and metabolic syndromePubMed 17618283
  5. NPY and stress resilience in humans: results of the World Trade Center survivor studyPubMed 21535899

Frequently Asked Questions