Peptide Schedule
Exenatide (Byetta / Bydureon)39 residuesHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Exenatide (Byetta / Bydureon)

Weight LossInjectionFDA ApprovedGrade A~2.4 hours (Byetta IR); ~2 weeks sustained release (Bydureon ER) half-life
GLP-1 AgonistType 2 DiabetesBlood Sugar ControlWeight ManagementFDA-Approved

Benefits

First-in-class GLP-1 receptor agonist with extensive long-term safety data
Reduces HbA1c by approximately 0.8-1.0% in clinical trials
Promotes weight loss of 2-3 kg over 30 weeks
Glucose-dependent insulin secretion minimizes hypoglycemia risk
Bydureon weekly formulation offers convenient dosing
Half-Life
~2.4 hours
Route
Injection
Frequency
2x Daily
Vial Sizes
0.25mg, 0.6mg
BAC Water
Pre-filled
Safety Grade
Grade A
Open Exenatide (Byetta / Bydureon) Dosage Calculator
Calculate exact syringe units for your vial and dose

About Exenatide (Byetta / Bydureon)

Exenatide is a synthetic version of exendin-4, a 39-amino-acid peptide originally discovered in the saliva of the Gila monster lizard. It was the first GLP-1 receptor agonist approved for type 2 diabetes (Byetta, FDA approved April 2005). Exenatide shares 53% sequence homology with human GLP-1 but resists degradation by DPP-4 enzyme, giving it a longer duration of action. It enhances glucose-dependent insulin secretion, suppresses inappropriately elevated glucagon, slows gastric emptying, and reduces appetite. Bydureon, an extended-release microsphere formulation approved in 2012, allows once-weekly dosing.

Who Should Consider Exenatide (Byetta / Bydureon)

  • Adults with type 2 diabetes not achieving adequate glycemic control with metformin, sulfonylurea, or both
  • Type 2 diabetics seeking a medication that also promotes modest weight loss
  • Patients who prefer weekly dosing (Bydureon) over daily injections
  • Adults with type 2 diabetes and cardiovascular risk factors
  • Patients who cannot tolerate or have contraindications to other oral diabetes agents

How Exenatide (Byetta / Bydureon) Works

Exenatide binds to and activates the GLP-1 receptor, a G-protein-coupled receptor expressed on pancreatic beta cells, the GI tract, and the central nervous system. In the pancreas, it enhances glucose-dependent insulin secretion and suppresses inappropriately elevated glucagon output. In the gut, it slows gastric emptying, which moderates postprandial glucose spikes and contributes to satiety. In the brain, it acts on hypothalamic appetite centers to reduce food intake. Unlike native GLP-1 (half-life ~2 minutes), exenatide resists DPP-4 enzymatic cleavage due to its exendin-4 backbone, extending its functional half-life to 2.4 hours. The Bydureon formulation uses poly(D,L-lactide-co-glycolide) microspheres to create a sustained-release depot, maintaining therapeutic plasma levels for a full week.

What to Expect

Weeks 1-4
5mcg twice daily

Initial titration phase. Nausea is most common during this period and typically subsides. Mild appetite reduction begins. Fasting glucose starts to improve. Body adjusts to GLP-1 receptor activation.

Weeks 5-12
10mcg twice daily

Full Byetta dose reached. HbA1c begins to drop measurably. Weight loss of 1-2 kg is typical. GI side effects diminish for most patients. Postprandial glucose excursions are noticeably blunted.

Weeks 13-30

Steady-state glycemic improvement. Phase 3 trials showed HbA1c reductions of 0.8-1.0% and weight loss of 2-3 kg by week 30. Appetite suppression stabilizes. Blood pressure may modestly decrease.

Weeks 30-52

Sustained glycemic and weight benefits. Open-label extension data showed continued HbA1c improvement and progressive weight loss up to 5 kg over 82 weeks. Beta-cell function markers improve.

Year 1+

Long-term maintenance of glycemic control. Two-year data showed sustained HbA1c reduction, ongoing weight loss, and improvements in hepatic biomarkers (AST, ALT). Regular monitoring of renal function and pancreatic enzymes recommended.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner5mcg2x Daily
Moderate10mcg2x Daily
Aggressive2mgWeekly

Note: First GLP-1 receptor agonist approved by the FDA (2005). Byetta: 5mcg or 10mcg twice daily via pre-filled pen. Bydureon: 2mg once weekly extended-release microsphere suspension. Titrate Byetta from 5mcg to 10mcg after 1 month. Carries a black box warning for medullary thyroid carcinoma risk.

How to Inject Exenatide (Byetta / Bydureon)

Byetta: Inject subcutaneously within 60 minutes before the two main meals of the day (at least 6 hours apart). Rotate injection sites (abdomen, thigh, upper arm). Start at 5mcg twice daily for at least 1 month, then increase to 10mcg twice daily if tolerated. Bydureon: Inject 2mg subcutaneously once weekly, any time of day, with or without meals. Same day each week. Reconstitute the microsphere suspension immediately before injection.

Cycling Protocol

On Period
52 weeks
Off Period
0 weeks

Exenatide is prescribed as continuous long-term therapy for type 2 diabetes management. No cycling is needed. Discontinuation should be discussed with a prescribing physician, as glycemic control may deteriorate.

Pharmacokinetics

Half-Life
2.4h
Bioavailability
SC: ~65-75% (estimated from clinical PK modeling)
Tmax
~2.1 hours (Byetta IR); 2-7 weeks to steady state (Bydureon ER)
Data Confidence
high

Source: Byetta FDA Prescribing Information, Section 12.3 — mean terminal half-life 2.4 hours

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Nausea (most common, typically decreases over time), vomiting, diarrhea. Injection site reactions with Bydureon (subcutaneous nodules). Rare: acute pancreatitis, renal impairment. Black box warning for thyroid C-cell tumors including medullary thyroid carcinoma (observed in rodent studies).

Contraindications

  • Personal or family history of medullary thyroid carcinoma (MTC) — black box warning
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN2)
  • History of severe hypersensitivity to exenatide or any product components
  • Severe renal impairment (CrCl <30 mL/min) or end-stage renal disease
  • History of pancreatitis
  • Pregnancy or breastfeeding — not studied; potential fetal harm based on animal data
  • Severe gastrointestinal disease (e.g., gastroparesis)
  • Type 1 diabetes or diabetic ketoacidosis — not indicated for these conditions

Drug Interactions

  • Insulin and sulfonylureas — increased risk of hypoglycemia; dose reduction of the sulfonylurea may be needed
  • Oral medications — delayed gastric emptying may affect absorption rate; take antibiotics and oral contraceptives at least 1 hour before exenatide injection
  • Warfarin — case reports of increased INR; monitor coagulation parameters closely when initiating or changing exenatide dose
  • Acetaminophen — Cmax decreased and Tmax delayed by approximately 2 hours when co-administered; clinical significance is limited
  • Digoxin — Cmax reduced by 17% and Tmax delayed by 2.5 hours; monitor digoxin levels
  • Lovastatin — AUC and Cmax decreased by approximately 40% and 28% respectively; consider timing of statin administration

Storage & Stability

Before Reconstitution
Pre-filled pens: refrigerate at 2-8°C before first use
After Reconstitution
Byetta pen in-use: room temperature up to 30°C for 30 days. Bydureon: use immediately after reconstitution
Temperature
2-8°C (36-46°F) until first use

Molecular Profile

Amino Acids
39
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Effects of exenatide on glycemic control over 30 weeks in sulfonylurea-treated patients with type 2 diabetes (Buse et al., Diabetes Care 2004)PubMed 15504997
  2. Effects of exenatide on glycemic control and weight over 30 weeks in metformin-treated patients (DeFronzo et al., Diabetes Care 2005)PubMed 15855572
  3. Effects of exenatide on glycemic control over 30 weeks in patients treated with metformin and a sulfonylurea (Kendall et al., Diabetes Care 2005)PubMed 15855571
  4. Effects of once-weekly exenatide on cardiovascular outcomes — EXSCEL trial (Holman et al., NEJM 2017)PubMed 28910237
  5. Metabolic effects of two years of exenatide treatment (Blonde et al., JCEM 2006)PubMed 17379054
  6. Byetta (exenatide) FDA Prescribing InformationFDA Label
  7. Bydureon (exenatide extended-release) FDA Prescribing InformationFDA Label

Frequently Asked Questions