Peptide Schedule
Liraglutide31 residuesHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Liraglutide

Weight LossInjectionFDA ApprovedGrade A~13 hours half-life
GLP-1 AgonistWeight ManagementAppetite Regulation

Benefits

FDA-approved for both type 2 diabetes (Victoza) and obesity (Saxenda)
Proven 13% reduction in major cardiovascular events in the LEADER trial
Average 8% body weight loss at the 3mg dose over 56 weeks
Short half-life means side effects clear within a day if you stop
Once-daily pre-filled pen — no mixing or reconstitution
Improves blood sugar control and insulin sensitivity
Approved for adolescent obesity ages 12 and up since 2020
Half-Life
~13 hours
Route
Injection
Frequency
Daily
Vial Sizes
18mg
BAC Water
Pre-filled
Safety Grade
Grade A
Open Liraglutide Dosage Calculator
Calculate exact syringe units for your vial and dose

About Liraglutide

Liraglutide is a GLP-1 receptor agonist that's been on the market longer than most people realize — FDA-approved as Victoza for type 2 diabetes back in 2010, then as Saxenda for chronic weight management in 2014. It's a modified version of human GLP-1 with a fatty acid side chain that lets it bind to albumin in the blood, extending its half-life from minutes to about 13 hours. That's long enough for once-daily dosing but short enough that side effects clear faster than weekly options like semaglutide if you don't tolerate it well. The LEADER trial, which enrolled over 9,300 patients with type 2 diabetes and high cardiovascular risk, showed liraglutide reduced major cardiovascular events by 13% compared to placebo. That was a big deal — it made Victoza one of the first diabetes drugs proven to protect the heart, not just lower blood sugar. On the weight loss side, the SCALE-Obesity and Prediabetes trial demonstrated an average loss of about 8% of body weight at the 3mg dose over 56 weeks. Not as dramatic as semaglutide's numbers, but still clinically meaningful. Saxenda comes as an 18mg pre-filled pen that delivers doses from 0.6mg to 3mg. You start low and titrate up weekly — 0.6mg the first week, 1.2mg the second, and so on until you hit the target dose. This slow ramp matters because GI side effects (especially nausea) are the most common reason people quit. Most find the nausea fades after 2-3 weeks at each dose level. One practical advantage of liraglutide over newer weekly GLP-1s: if you get hit hard by side effects, they clear out in about a day since the drug's half-life is only 13 hours. With semaglutide, you're stuck waiting a week. That makes liraglutide a reasonable starting point for people who are nervous about GLP-1 therapy or have a history of GI sensitivity.

Who Should Consider Liraglutide

  • Adults with BMI ≥30 (or ≥27 with weight-related comorbidity)
  • Type 2 diabetics needing glycemic control with cardiovascular benefit
  • Adolescents aged 12+ with obesity
  • People who want a daily GLP-1 with faster side-effect clearance than weekly options
  • Those new to GLP-1 therapy who prefer a conservative start

How Liraglutide Works

Liraglutide is a long-acting analog of human glucagon-like peptide-1 (GLP-1) with 97% amino acid homology to the native hormone. A C-16 fatty acid (palmitic acid) is attached via a glutamic acid spacer at position 26, which promotes non-covalent binding to serum albumin. This albumin binding shields the molecule from DPP-IV and neutral endopeptidase degradation, slows absorption from the injection site, and extends the plasma half-life from about 2 minutes (native GLP-1) to roughly 13 hours. Once in circulation, liraglutide activates GLP-1 receptors in multiple tissues. In the pancreas, it enhances glucose-dependent insulin secretion and suppresses inappropriate glucagon release — but only when blood sugar is elevated, which is why hypoglycemia risk is low alone. In the GI tract, it slows gastric emptying by 10-15%. In the brain, it acts on hypothalamic and brainstem GLP-1 receptors to reduce appetite and food reward signaling. The cardiovascular benefits seen in LEADER likely involve direct vascular endothelial effects and anti-inflammatory pathways.

What to Expect

Weeks 1-4

Titration phase — dose increases weekly from 0.6mg to 2.4mg. Appetite suppression begins within days. Nausea most common but typically improves.

Weeks 5-8

Full dose (3mg) reached. Noticeable reduction in hunger. Most see 2-4% body weight loss by week 8.

Weeks 9-26

Steady weight loss of 0.5-1 lb per week. Blood sugar improvements measurable on labs.

Weeks 27-56

Weight loss approaches 8% average from SCALE trial. Cardiovascular markers improve. Rate slows near equilibrium.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner600mcgDaily
Moderate1,800mcgDaily
Aggressive3mgDaily

Note: Pre-filled pen — no reconstitution needed. Titrate up by 600mcg each week to minimize nausea. Saxenda tops out at 3mg/day for weight loss; Victoza caps at 1.8mg/day for diabetes.

How to Inject Liraglutide

Liraglutide comes as a pre-filled, multi-dose pen — no reconstitution needed. Inject subcutaneously once daily at any time, with or without meals. The abdomen and upper arm give best absorption; the thigh works but absorption drops by about 22%. Rotate injection sites. Titration for Saxenda: 0.6mg daily for week 1, 1.2mg week 2, 1.8mg week 3, 2.4mg week 4, then 3.0mg ongoing.

Cycling Protocol

On Period
52 weeks
Off Period
0 weeks

Designed for continuous long-term use. Weight regain expected after discontinuation. If you miss more than 3 consecutive days, restart at 0.6mg and re-titrate.

Pharmacokinetics

Half-Life
13h
Bioavailability
SC: ~55%
Tmax
8-12 hours
Data Confidence
high

Source: FDA Prescribing Information (Victoza), Section 12.3

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

GI side effects are the main issue with liraglutide, and you should expect them — at least initially. Nausea hits roughly 40% of people at the 3mg dose, though it's usually worst during the first few weeks of each dose increase and fades with time. Vomiting, diarrhea, and constipation are also common, affecting 15-20% of users. Slow titration helps a lot here. More serious but less common: pancreatitis occurs in under 0.4% of patients, and gallbladder problems (gallstones, cholecystitis) show up in about 2.2%. There's a black box warning about medullary thyroid carcinoma based on rodent studies — it hasn't been confirmed in humans, but it's enough to make liraglutide off-limits if you or a family member has a history of medullary thyroid cancer or MEN2 syndrome. Hypoglycemia is rare on its own but becomes a real risk when combined with insulin or sulfonylureas. Injection site reactions are mild and infrequent.

Contraindications

  • Personal or family history of medullary thyroid carcinoma (MTC)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN2)
  • History of pancreatitis
  • Pregnancy or planning to become pregnant (stop at least 2 months before conception)
  • Breastfeeding — liraglutide was detected in milk of lactating rats; human data are insufficient to assess infant risk
  • Known hypersensitivity to liraglutide

Drug Interactions

  • Insulin and sulfonylureas — increased hypoglycemia risk, dose reduction often needed
  • Oral medications may have delayed absorption due to slowed gastric emptying
  • Digoxin — AUC reduced by approximately 16%; monitor levels
  • Oral contraceptives — Cmax reduced by 12%; take at least 1 hour before injection

Storage & Stability

Before Reconstitution
Not applicable — pre-filled pen, store unused pens refrigerated at 2-8°C until expiration date
After Reconstitution
In-use pen can be kept at room temperature (up to 30°C) or refrigerated for 30 days
Temperature
2-8°C (36-46°F) before first use; up to 30°C (86°F) after first use

Molecular Profile

Amino Acids
31
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. LEADER Trial — Liraglutide and Cardiovascular Outcomes in Type 2 DiabetesPubMed 27295427
  2. SCALE Obesity and Prediabetes TrialPubMed 25673007
  3. Victoza (Liraglutide) FDA Prescribing InformationFDA Label

Frequently Asked Questions