Peptide Schedule
Dulaglutide (Trulicity)30 residuesHGEGTFTSDVSSYLEGQAAKEFIAWLVKGREach bubble = one amino acid. Size = residue mass. Color = chemical class.

Dulaglutide (Trulicity)

Weight LossInjectionFDA ApprovedGrade A~5 days (120 hours) half-life
GLP-1 AgonistType 2 DiabetesCardiovascularWeight ManagementFDA-Approved

Benefits

FDA-approved for type 2 diabetes with proven glycemic control
Reduces major adverse cardiovascular events (REWIND trial: HR 0.88)
Convenient once-weekly pre-filled pen — no reconstitution required
Dose-dependent HbA1c reductions of 1.0-1.6% across AWARD trials
Promotes moderate weight loss (1.5-4.6 kg depending on dose)
Shown to slow eGFR decline and reduce new macroalbuminuria
Half-Life
~5 days
Route
Injection
Frequency
Weekly
Vial Sizes
0.75mg, 1.5mg, 3mg, 4.5mg
BAC Water
Pre-filled
Safety Grade
Grade A
Open Dulaglutide (Trulicity) Dosage Calculator
Calculate exact syringe units for your vial and dose

About Dulaglutide (Trulicity)

Dulaglutide (brand name Trulicity) is an FDA-approved GLP-1 receptor agonist manufactured by Eli Lilly for the treatment of type 2 diabetes and reduction of major adverse cardiovascular events. It is a fusion protein consisting of two GLP-1 analog sequences linked to a modified human IgG4 Fc domain, giving it a molecular weight of approximately 63 kDa and a half-life of about 5 days. This allows convenient once-weekly dosing via a pre-filled, single-use pen. The REWIND trial demonstrated a 12% reduction in major cardiovascular events over a median 5.4-year follow-up, making it the first GLP-1 agonist to show cardiovascular benefit in a population with and without established cardiovascular disease.

Who Should Consider Dulaglutide (Trulicity)

  • Adults with type 2 diabetes requiring improved glycemic control
  • Type 2 diabetics at elevated risk for major adverse cardiovascular events
  • Adults with type 2 diabetes and established cardiovascular disease
  • Patients seeking a once-weekly injectable with no reconstitution needed
  • Type 2 diabetics with moderate-to-severe chronic kidney disease (AWARD-7 data)
  • Adults who prefer a pre-filled pen over daily injectable GLP-1 therapies

How Dulaglutide (Trulicity) Works

Dulaglutide is a GLP-1 receptor agonist fusion protein. It consists of a GLP-1 analog (90% homologous to native GLP-1) covalently linked to a modified IgG4 Fc domain via a small peptide linker, forming a ~63 kDa homodimer. Upon binding GLP-1 receptors on pancreatic beta cells, it activates adenylyl cyclase, raising intracellular cAMP to stimulate glucose-dependent insulin secretion. It also suppresses inappropriately elevated glucagon from alpha cells, slows gastric emptying to blunt postprandial glucose spikes, and acts on hypothalamic satiety centers to reduce appetite. The IgG4 Fc domain reduces renal clearance and extends the half-life to approximately 5 days, supporting weekly dosing.

What to Expect

Weeks 1-4
0.75mg

Starting dose. GI side effects (nausea, diarrhea) are most common during this period and typically mild. Early blood sugar improvements begin. HbA1c reduction of approximately 0.5-0.7% expected. Appetite changes may start.

Weeks 5-8
1.5mg

First dose increase if glycemic targets are not met. GI effects often lessen as the body adjusts. HbA1c reductions of approximately 1.0-1.2% from baseline. Mild weight loss of 1-2 kg may occur.

Weeks 9-16
3.0mg if needed

Higher dose option available since AWARD-11. Further HbA1c reduction (up to 1.5% from baseline). Weight loss becomes more apparent. Steady-state drug levels are well established by this point.

Weeks 17-26
up to 4.5mg

Maximum dose. AWARD-11 showed HbA1c reductions up to 1.87% and weight loss of 4.6 kg at 36 weeks with 4.5mg. Fasting glucose and postprandial glucose control optimize. GI side effects generally resolved.

Week 26+

Long-term maintenance. REWIND trial showed sustained cardiovascular protection over 5.4 years of use. HbA1c and weight benefits are maintained while on therapy. Renal protective effects observed with prolonged use.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner0.75mgWeekly
Moderate1.5mgWeekly
Aggressive4.5mgWeekly

Note: FDA-approved GLP-1 receptor agonist for type 2 diabetes and cardiovascular risk reduction. Delivered via pre-filled single-use pen (Trulicity). Titrate from 0.75mg weekly; may increase every 4 weeks. Max dose 4.5mg/week.

How to Inject Dulaglutide (Trulicity)

Administer once weekly via the pre-filled Trulicity pen. Inject subcutaneously into the abdomen, thigh, or upper arm. Rotate injection sites with each dose. Can be administered at any time of day, with or without food. Take on the same day each week; the day may be changed if needed as long as the last dose was given 3 or more days prior. No reconstitution or needle attachment is required — the pen auto-injects upon activation.

Cycling Protocol

On Period
52 weeks
Off Period
0 weeks

Dulaglutide is used continuously as a chronic therapy for type 2 diabetes. No cycling is required or recommended. Discontinuation should be discussed with a prescribing physician, as glycemic control and cardiovascular benefits depend on ongoing use.

Pharmacokinetics

Half-Life
120h
Bioavailability
SC: ~47-65% (dose-dependent; 65% at 0.75mg, 47% at 1.5mg)
Tmax
~48 hours (range 24-72h)
Data Confidence
high

Source: FDA Prescribing Information (Trulicity), Section 12.3; Geiser et al. Clin Pharmacokinet 2016 PMID:26507721

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Nausea, diarrhea, vomiting, abdominal pain, and decreased appetite are the most common (affecting 8-21% of patients). GI side effects are dose-dependent and typically diminish with continued use. Rare but serious risks include pancreatitis, medullary thyroid carcinoma (boxed warning in rodent studies), and hypoglycemia when combined with insulin or sulfonylureas.

Contraindications

  • Personal or family history of medullary thyroid carcinoma (MTC)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN2)
  • History of serious hypersensitivity reaction to dulaglutide or any product components
  • History of pancreatitis — use with caution; discontinue if pancreatitis is suspected
  • Pregnancy or breastfeeding — may cause fetal harm based on animal data; discontinue at least 2 months before planned pregnancy due to long washout
  • Severe gastrointestinal disease including gastroparesis
  • Type 1 diabetes or diabetic ketoacidosis — not indicated for these conditions

Drug Interactions

  • Insulin and sulfonylureas — increased risk of hypoglycemia; dose reduction of insulin or sulfonylurea may be needed
  • Oral medications — slowed gastric emptying may delay absorption of concomitant oral drugs
  • Warfarin — monitor INR more frequently when initiating or changing dulaglutide dose
  • Oral contraceptives — no clinically meaningful interaction observed, but consider potential delayed absorption
  • Levothyroxine — monitor thyroid levels as GI transit changes may alter absorption

Storage & Stability

Before Reconstitution
N/A — supplied as liquid in pre-filled pen
After Reconstitution
Refrigerate at 2-8°C in original carton. May store at room temperature (up to 30°C) for up to 14 days.
Temperature
2-8°C (36-46°F); up to 30°C (86°F) for 14 days

Molecular Profile

Amino Acids
30
Sequence
HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Dulaglutide and cardiovascular outcomes in type 2 diabetes (REWIND)PubMed 31189511
  2. Efficacy and Safety of Dulaglutide 3.0 mg and 4.5 mg (AWARD-11)PubMed 33397768
  3. Efficacy and safety of dulaglutide (AWARD-1)PubMed 24879836
  4. Once-weekly dulaglutide versus once-daily liraglutide (AWARD-6)PubMed 25018121
  5. Clinical Pharmacokinetics of DulaglutidePubMed 26507721
  6. Trulicity (Dulaglutide) FDA Prescribing InformationFDA Label

Frequently Asked Questions