Peptide Schedule
Defensin (HNP-1)30 residuesACYCRIPACIAGERRYGTCIYQGRLWAFCCEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Defensin (HNP-1)

ImmuneInjectionResearchGrade C~3-4 hours (estimated, based on peptide clearance kinetics) half-life
Alpha-DefensinAntimicrobial PeptideInnate ImmunityNeutrophilImmunomodulationAntiviralHost Defense Peptide8 weeks on / 4 weeks off

Benefits

Broad-spectrum antimicrobial activity against bacteria, fungi, and enveloped viruses
Chemoattractant for monocytes, naive T cells, and immature dendritic cells
Bridges innate and adaptive immune responses through dendritic cell maturation
Enhances macrophage phagocytosis and pathogen opsonization
Augments complement-mediated immune defense
Potential antitumor activity through membrane disruption and apoptosis induction
Stimulates pro-inflammatory cytokine production for pathogen clearance
Half-Life
~3-4 hours
Route
Injection
Frequency
3x/week
Vial Sizes
1mg, 5mg
BAC Water
2mL
Safety Grade
Grade C
Open Defensin (HNP-1) Dosage Calculator
Calculate exact syringe units for your vial and dose

About Defensin (HNP-1)

Human Neutrophil Peptide-1 (HNP-1) belongs to the alpha-defensin family, a class of small cationic antimicrobial peptides that serve as critical effectors of the innate immune system. HNP-1, along with its close homologs HNP-2 and HNP-3 (which differ only in their N-terminal amino acid), is stored in the azurophilic granules of neutrophils and released upon neutrophil activation during infection or inflammation. The peptide exerts broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, and enveloped viruses including HIV-1, influenza A, and herpes simplex virus. Its mechanism of direct microbial killing involves electrostatic attraction to negatively charged phospholipid membranes, followed by membrane insertion, pore formation, and disruption of membrane integrity leading to osmotic lysis. Beyond direct antimicrobial effects, HNP-1 serves as a multifunctional immunomodulatory molecule. It acts as a chemoattractant for monocytes, naive T cells, and immature dendritic cells, effectively bridging innate and adaptive immunity. HNP-1 enhances phagocytosis by macrophages, promotes dendritic cell maturation, and stimulates the production of pro-inflammatory cytokines including TNF-alpha, IL-1beta, and IL-6. It also augments complement activation and can directly opsonize pathogens. Research interest in HNP-1 has expanded to include its potential antitumor properties. Studies have demonstrated that defensins can inhibit tumor cell proliferation and induce apoptosis in certain cancer cell lines, likely through membrane disruption mechanisms similar to their antimicrobial activity. Elevated serum HNP-1 levels have been identified as potential biomarkers in several cancers, including colorectal and bladder cancer, though whether this elevation is protective or merely a marker of neutrophil activation remains under investigation.

Who Should Consider Defensin (HNP-1)

  • Researchers studying innate immune defense mechanisms and antimicrobial peptides
  • Scientists investigating host defense peptide-based approaches to antibiotic resistance
  • Researchers exploring defensin-based antitumor peptide strategies
  • Immunologists studying dendritic cell maturation and adaptive immunity bridging
  • Individuals with recurrent infections seeking immune support under medical supervision

How Defensin (HNP-1) Works

HNP-1 exerts its antimicrobial effects primarily through direct membrane disruption. The cationic peptide (net charge +3 at physiological pH) is electrostatically attracted to the anionic phospholipid headgroups that predominate on microbial membranes, in contrast to the zwitterionic phospholipids of mammalian cell membranes. Upon binding, HNP-1 oligomerizes and inserts into the lipid bilayer, forming multimeric pores that collapse transmembrane electrochemical gradients and cause osmotic lysis. For Gram-negative bacteria, HNP-1 must first traverse the outer membrane by displacing divalent cations (Mg2+ and Ca2+) that stabilize lipopolysaccharide (LPS) interactions. Once through the outer membrane, it disrupts the inner membrane through the same pore-forming mechanism. Against enveloped viruses such as HIV-1, HNP-1 interferes with viral glycoprotein-mediated fusion and directly damages the viral lipid envelope. The immunomodulatory functions of HNP-1 operate through distinct receptor-mediated pathways. It binds to CCR6 on immature dendritic cells and memory T cells, functioning as a chemokine to recruit these cells to sites of infection. HNP-1 promotes dendritic cell maturation by upregulating MHC class II, CD80, CD86, and CD83 expression, enhancing antigen presentation capacity. It activates macrophages via TLR4-dependent signaling, increasing phagocytic activity and pro-inflammatory cytokine release through NF-kB activation. HNP-1 also enhances complement activation by binding to C1q and activating the classical pathway.

What to Expect

Week 1

Treatment initiation at low dose. HNP-1 begins circulating and interacting with immune cells. Assess injection site tolerance and monitor for excessive local inflammation. Baseline bloodwork (CBC with differential, CRP, ESR) recommended.

Weeks 2-3

Early immunomodulatory effects may begin. Neutrophil and monocyte activity may show subtle enhancement. Dendritic cell recruitment to peripheral tissues is theoretically increased.

Weeks 4-6

Cumulative immune priming effects expected. In animal models, sustained defensin exposure produces measurable increases in macrophage phagocytic activity and dendritic cell maturation markers.

Weeks 6-8

Peak treatment window. Adaptive immune bridging effects (T-cell recruitment, enhanced antigen presentation) should be most apparent. Full bloodwork recommended.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner50mcg3x/week
Moderate100mcgDaily
Aggressive200mcgDaily

Note: Human Neutrophil Peptide-1 (HNP-1) is a 30-amino-acid alpha-defensin with a molecular weight of approximately 3,442 Da. It is one of the most abundant antimicrobial peptides found in human neutrophil azurophilic granules, constituting up to 5-7% of total neutrophil protein. HNP-1 forms a triple-stranded beta-sheet structure stabilized by three intramolecular disulfide bonds (Cys2-Cys30, Cys4-Cys19, Cys9-Cys29), which are essential for its antimicrobial and immunomodulatory activity. It is cationic at physiological pH, enabling electrostatic interactions with negatively charged microbial membranes. Research use only — no approved human therapeutic indications exist. Typical research dosing is extrapolated from in vitro antimicrobial concentrations and animal studies.

How to Inject Defensin (HNP-1)

Subcutaneous injection into abdominal fat, rotating injection sites. Reconstitute lyophilized powder with bacteriostatic water — gently swirl, do not shake, as defensins can aggregate at air-water interfaces. Allow vial to reach room temperature before injection. Inject at a consistent time each day. Start at the beginner dose for the first 1-2 weeks to assess tolerance before escalating. Monitor for excessive injection site inflammation, which may indicate local cytotoxicity at higher concentrations. Store reconstituted vials upright in the refrigerator. This is a research compound — all dosing is extrapolated from in vitro antimicrobial concentrations and animal model studies.

Cycling Protocol

On Period
8 weeks
Off Period
4 weeks

No established human cycling protocols exist. The 8-on/4-off recommendation is conservative and based on general immune peptide cycling principles. Monitor inflammatory markers (CRP, ESR) during use. Discontinue if signs of excessive inflammation develop.

Pharmacokinetics

Half-Life
3.5h
Bioavailability
SC: estimated 60-80% based on peptide size (3,442 Da) and cationic charge
Tmax
Estimated 1-2 hours SC based on peptide size and subcutaneous absorption kinetics
Data Confidence
low

Source: No formal PK studies of exogenous HNP-1 in humans. Estimated 3-4 hours based on cationic peptide clearance kinetics for peptides in the 3-4 kDa range.

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

HNP-1 safety data in humans is limited to observational studies of endogenous levels. At high concentrations, alpha-defensins can be cytotoxic to host cells, causing membrane damage to epithelial and endothelial cells. This cytotoxicity is concentration-dependent and represents the primary theoretical risk of exogenous administration. Injection site reactions including redness, swelling, and pain are expected. Elevated systemic defensin levels have been associated with inflammatory conditions including acute respiratory distress syndrome (ARDS) and atherosclerosis, raising concern that exogenous supplementation could exacerbate vascular inflammation. Potential pro-inflammatory effects (elevated TNF-alpha, IL-1beta) may worsen autoimmune conditions. No formal adverse event profiles from clinical trials exist, as HNP-1 has not entered human clinical testing as a therapeutic agent.

Contraindications

  • Active autoimmune disease — HNP-1 stimulates pro-inflammatory cytokines and immune cell recruitment
  • Acute respiratory distress syndrome (ARDS) or severe pulmonary inflammation
  • Active atherosclerosis or cardiovascular disease — HNP-1 linked to endothelial dysfunction
  • Organ transplant recipients on immunosuppressants — immune activation risks graft rejection
  • Pregnancy or breastfeeding — no reproductive safety data
  • Sepsis or systemic inflammatory response syndrome (SIRS)

Drug Interactions

  • Immunosuppressants (cyclosporine, tacrolimus, mycophenolate) — HNP-1 immune-activating effects may counteract immunosuppressive therapy
  • Corticosteroids — may reduce endogenous defensin release; exogenous HNP-1 effects may be blunted
  • Anticoagulants (heparin, warfarin) — HNP-1 can neutralize heparin's anticoagulant activity
  • Other antimicrobial peptides (LL-37, Thymosin Alpha 1) — additive or synergistic immune stimulation
  • Checkpoint inhibitors (nivolumab, pembrolizumab) — combined immune activation effects unstudied
  • NSAIDs — may partially counteract HNP-1-induced pro-inflammatory signaling

Storage & Stability

Before Reconstitution
Store at -20°C for long-term stability. Stable at 2-8°C for up to 4 weeks.
After Reconstitution
Refrigerate at 2-8°C, use within 14 days. Do not freeze reconstituted solution.
Temperature
2-8°C (36-46°F) for active use; -20°C for long-term storage

Molecular Profile

Amino Acids
30
Sequence
ACYCRIPACIAGERRYGTCIYQGRLWAFCC
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Defensins: antimicrobial peptides of innate immunity (Ganz, 2003)Review
  2. Crystal structure of human defensin HNP-3, an amphiphilic dimer (Hill et al., 1991)PubMed 2016748
  3. Human defensins inhibit HIV replication in vitro (Chang et al., 2005)PubMed 15681380
  4. Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6 (Yang et al., 1999)PubMed 10517564
  5. Antimicrobial peptides: pore formers or metabolic inhibitors in bacteria? (Brogden, 2005)Review
  6. Human alpha-defensin HNP1 increases HIV-1 infectivity in vitro (Demirkhanyan et al., 2012)PubMed 22647697

Frequently Asked Questions