Peptide Schedule
LL-3737 residuesLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESEach bubble = one amino acid. Size = residue mass. Color = chemical class.

LL-37

ImmuneInjectionPreclinicalGrade B~4-6 hours half-life
Antimicrobial PeptideBiofilm DisruptionInnate ImmunityWound HealingCathelicidin

Benefits

Broad-spectrum antimicrobial: bacteria, viruses, fungi
Breaks down bacterial biofilms
Enhances innate immune defense
Promotes wound healing
Modulates inflammatory response
Half-Life
~4-6 hours
Route
Injection
Frequency
2x/week
Vial Sizes
5mg
BAC Water
2mL
Safety Grade
Grade B
Open LL-37 Dosage Calculator
Calculate exact syringe units for your vial and dose

About LL-37

LL-37 is the only human cathelicidin antimicrobial peptide, naturally produced by immune cells, epithelial cells, and barrier tissues. It's a 37-amino-acid peptide that forms the body's first line of innate immune defense. It directly kills bacteria, viruses, and fungi by disrupting their membranes, and is uniquely effective at breaking down biofilms — the protective structures bacteria form in chronic infections. It also modulates the immune response and promotes wound healing.

Who Should Consider LL-37

  • Individuals with chronic or recurrent bacterial infections
  • Patients with biofilm-associated infections (chronic wounds, implant infections)
  • Those with slow-healing or non-healing wounds
  • People with compromised innate immune function
  • Individuals recovering from skin injuries or surgical wounds

How LL-37 Works

LL-37 is a 37-amino-acid cationic peptide cleaved from the precursor protein hCAP-18 by proteinase 3 in neutrophil granules. Its amphipathic alpha-helical structure allows it to interact with negatively charged bacterial membranes through electrostatic attraction. Once bound, the hydrophobic face of LL-37 inserts into the lipid bilayer, forming toroidal pores or disrupting membrane integrity through a carpet-like mechanism, leading to rapid bacterial lysis. Against biofilms, LL-37 penetrates the extracellular polymeric matrix, disrupts bacterial communication (quorum sensing), and kills embedded bacteria that are otherwise resistant to conventional antibiotics. Beyond direct antimicrobial killing, LL-37 binds and neutralizes lipopolysaccharide (LPS) and lipoteichoic acid, preventing excessive inflammatory signaling from bacterial endotoxins. It acts as a chemoattractant for neutrophils, monocytes, and T-cells through formyl peptide receptor-like 1 (FPRL1) activation, recruiting immune cells to sites of infection or injury. LL-37 also stimulates wound healing by promoting angiogenesis through VEGF upregulation, enhancing keratinocyte and epithelial cell migration, and increasing collagen deposition. At low concentrations, it suppresses pro-inflammatory cytokine release from macrophages, while at higher concentrations it can amplify inflammatory responses — making dose selection important for therapeutic applications.

What to Expect

Days 1-3

Treatment initiation. LL-37 begins circulating and interacting with target tissues. Injection site redness or mild soreness is common at this stage. No noticeable systemic changes yet.

Days 4-10

Early immune activation. Innate immune cell recruitment increases at infection or wound sites. Some users report reduced redness or drainage from chronic wounds. Mild flu-like symptoms may occur as immune activity ramps up.

Weeks 2-3

Antimicrobial and wound-healing effects become more apparent. Biofilm disruption allows better immune clearance of chronic infections. Wound granulation tissue formation and re-epithelialization may accelerate.

Weeks 4-6

Peak therapeutic window. Measurable improvements in wound closure, reduced bacterial load at infection sites, and stronger innate immune markers. Cycle typically ends here — reassess before continuing.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner50mcg2x/week
Moderate100mcg2x/week
Aggressive200mcg3x/week

Note: Human cathelicidin antimicrobial peptide. Very potent — use low doses. Broad-spectrum antimicrobial activity against bacteria, viruses, fungi, and biofilms. Cycle 4-6 weeks. Monitor for injection site reactions.

Pharmacokinetics

Half-Life
5h
Bioavailability
SC: not formally established; rapid local absorption expected
Tmax
~1-2 hours (SC, estimated)
Data Confidence
low

Source: Estimated 4-6 hours based on proteolytic degradation kinetics in serum and wound fluid (PMID 21547341)

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Injection site pain and redness (common at higher doses). Transient flu-like symptoms. Use low doses — LL-37 is very potent. Rare: allergic reaction.

Contraindications

  • Pregnancy or breastfeeding — no safety data available in these populations
  • Known hypersensitivity to LL-37 or cathelicidin-derived peptides
  • Active autoimmune conditions (psoriasis, lupus) — LL-37 is elevated in psoriatic lesions and may worsen flares
  • Active malignancy — LL-37 has mixed effects on tumor cells and may promote angiogenesis
  • Children under 18 — not studied in pediatric populations

Drug Interactions

  • Immunosuppressants (corticosteroids, cyclosporine, methotrexate) — may blunt LL-37 immune-stimulating effects
  • Other antimicrobial peptides or immune-stimulating peptides (Thymosin Alpha-1, KPV) — additive immune activation; use caution with stacking
  • Anticoagulants (warfarin, heparin) — LL-37 may interact with heparin-binding sites; monitor coagulation parameters
  • Topical antimicrobials — potential additive effects when LL-37 is used alongside wound care agents

Molecular Profile

Amino Acids
37
Molecular Weight
4,493.33 Da
Sequence
[LL-37, 37 aa]
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. LL-37, the only human member of the cathelicidin family of antimicrobial peptides (Biochim Biophys Acta 2006)PubMed 16716248
  2. Cathelicidin LL-37: a multitask antimicrobial peptide (Arch Immunol Ther Exp 2010)PubMed 20049649
  3. Wound healing activity of the human antimicrobial peptide LL37 (J Invest Dermatol 2011)PubMed 21693141
  4. The human cathelicidin antimicrobial peptide LL-37 as a potential treatment for polymicrobial infected wounds (Front Immunol 2013)PubMed 23840194
  5. Stability of the cathelicidin peptide LL-37 in a non-healing wound environment (Peptides 2011)PubMed 21547341
  6. Therapeutic potential of cathelicidin peptide LL-37 in a murine sepsis model (Int J Mol Sci 2020)PubMed 32825174

Frequently Asked Questions