Peptide Schedule
Thymosin Beta-443 residuesSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGESEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Thymosin Beta-4

Healing & RecoveryInjectionResearchGrade B~2 hours (IV) half-life
Accelerated HealingAnti-InflammatoryAnti-FibroticCardiovascular SupportCellular RegenerationNeuroprotection4 weeks on / 2 weeks off

Benefits

Full-spectrum tissue repair with all functional domains intact
Cardioprotective via Ac-SDKP domain (not present in TB-500)
Promotes angiogenesis and new blood vessel formation
Reduces inflammation and fibrosis (scar tissue)
Activates endogenous cardiac progenitor cells
Accelerates wound healing and reduces scarring
Neuroprotective properties observed in TBI models
Half-Life
~2 hours
Route
Injection
Frequency
Daily
Vial Sizes
2mg, 5mg
BAC Water
1mL
Safety Grade
Grade B
Open Thymosin Beta-4 Dosage Calculator
Calculate exact syringe units for your vial and dose

About Thymosin Beta-4

Thymosin Beta-4 (Tb4) is the full-length 43-amino-acid protein and the primary G-actin sequestering peptide in the human body. Unlike TB-500, which contains only the central actin-binding fragment (amino acids 17-23), full-length Tb4 retains additional functional domains including the Ac-SDKP sequence responsible for cardioprotective and anti-fibrotic effects. Tb4 promotes wound healing, angiogenesis, and tissue regeneration while reducing inflammation and scar formation. It is the first known molecule demonstrated to simultaneously initiate myocardial and vascular regeneration after systemic administration in preclinical models.

Who Should Consider Thymosin Beta-4

  • Athletes recovering from soft tissue injuries requiring full-spectrum healing support
  • Post-surgical patients seeking accelerated wound healing with reduced scarring
  • Individuals with cardiac tissue damage or post-myocardial infarction recovery (preclinical evidence)
  • Patients with chronic fibrotic conditions (pulmonary, hepatic, or dermal fibrosis)
  • Older adults with impaired wound healing capacity
  • Those with corneal injuries or dry eye conditions (ophthalmic formulations studied in trials)
  • Individuals recovering from traumatic brain injury (preclinical evidence)

How Thymosin Beta-4 Works

Thymosin Beta-4 sequesters G-actin monomers to regulate actin polymerization, directly controlling cell migration, proliferation, and differentiation. The LKKTETQ domain (shared with TB-500) binds actin and promotes angiogenesis and cell motility. The Ac-SDKP tetrapeptide, released by enzymatic cleavage from the N-terminus, provides distinct cardioprotective effects by attenuating inflammatory macrophage infiltration, reducing fibrosis, and protecting cardiomyocytes from oxidative stress. Tb4 also activates integrin-linked kinase (ILK), promoting cardiac progenitor cell activation and epicardial cell migration. After tissue injury, Tb4 is released by platelets and macrophages to protect surrounding cells from further damage.

What to Expect

Weeks 1-2

Loading phase begins with daily dosing. Due to the short half-life, steady-state levels are reached quickly. Early anti-inflammatory effects may be noticeable. Mild fatigue or headache possible during adjustment.

Weeks 3-4

Continued loading phase. Angiogenesis and tissue repair processes accelerate. Noticeable reduction in pain and inflammation around injured areas. Improved flexibility and range of motion.

Weeks 5-6

Transition to maintenance dosing (half dose daily or every other day). Significant healing progress in soft tissue and dermal wounds. Reduced scar tissue formation at injury sites.

Weeks 7+

Maintenance phase continues. Sustained healing support and anti-fibrotic activity. Evaluate progress and consider cycling off. Resume loading if new injury occurs.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner750mcgDaily
Moderate1,500mcgDaily
Aggressive3mgDaily

Note: Full-length 43-amino-acid protein, distinct from TB-500 which is only the 7-amino-acid active fragment. Due to short half-life, daily dosing is standard. Loading phase of 2-4 weeks at higher dose, then reduce to maintenance. Store reconstituted vial refrigerated.

How to Inject Thymosin Beta-4

Inject subcutaneously in the abdomen or thigh. Tb4 is systemic and does not need to be injected near the injury site. Due to the short half-life, daily administration is standard. IV administration has been used in clinical trials but is less practical for routine use. Rotate injection sites.

Cycling Protocol

On Period
4 weeks
Off Period
2 weeks

Loading phase: full dose daily for 2-4 weeks. Then maintenance: half dose daily or every other day. Short half-life (~2 hours) necessitates more frequent dosing than TB-500. Cycle off periodically to assess progress.

Pharmacokinetics

Half-Life
2h
Bioavailability
IV: 100%; SC: not formally characterized in humans
Tmax
IV: immediate; SC: not characterized
Data Confidence
moderate

Source: Phase I IV PK study in healthy volunteers (PMID 20536472): mean half-life ranged from 0.95h (42 mg) to 2.1h (1260 mg), dose-dependent

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Headache, mild nausea, lightheadedness. Temporary fatigue during loading phase. Injection site redness or irritation. In clinical trials, adverse events were infrequent and mild to moderate with no dose-limiting toxicities reported.

Contraindications

  • Active cancer or personal history of cancer — Tb4 promotes angiogenesis and cell proliferation, which may support tumor growth and vascularization
  • Pregnancy or breastfeeding — no safety data available in pregnant or lactating individuals
  • Active systemic infections — enhanced cell migration and immune modulation could theoretically complicate infection management
  • Known hypersensitivity to thymosin beta-4 or any component of the formulation
  • Concurrent use of anti-VEGF therapies (bevacizumab) — directly opposes Tb4 angiogenic mechanism

Drug Interactions

  • Anticoagulants (warfarin, heparin, DOACs) — Tb4 promotes angiogenesis and may increase bleeding risk at healing sites
  • ACE inhibitors — ACE degrades the Ac-SDKP fragment of Tb4; inhibiting ACE may increase Ac-SDKP levels and potentiate anti-fibrotic effects
  • Anti-VEGF therapies (bevacizumab, ranibizumab) — directly opposes Tb4 mechanism of action; concurrent use is contraindicated
  • Immunosuppressants — Tb4 modulates immune cell migration and macrophage activity; effect on immunosuppressive therapy is unknown
  • Other angiogenic healing peptides (BPC-157, TB-500) — additive angiogenic effects; monitor closely when stacking

Storage & Stability

Before Reconstitution
Refrigerate at 2-8°C, stable up to 24 months
After Reconstitution
Refrigerate, use within 2-3 weeks
Temperature
2-8°C (36-46°F)

Molecular Profile

Amino Acids
43
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Thymosin beta4 and cardiac repairPubMed 20536454
  2. Thymosin beta-4: a multi-functional regenerative peptide — basic properties and clinical applicationsPubMed 22074294
  3. A randomized, placebo-controlled, single and multiple dose study of intravenous thymosin beta4 in healthy volunteersPubMed 20536472
  4. First-in-human phase I study of recombinant human thymosin beta-4 in healthy Chinese volunteersPubMed 34346165
  5. Thymosin beta4 is cardioprotective after myocardial infarctionPubMed 17600280
  6. Thymosin Beta-4: Roles in Development, Repair, and Engineering of the Cardiovascular SystemPubMed 27450737
  7. Thymosin beta4-sulfoxide attenuates inflammatory cell infiltration and promotes cardiac wound healingPubMed 23820300
  8. Recombinant thymosin beta 4 can promote full-thickness cutaneous wound healingPubMed 17923415

Frequently Asked Questions