Peptide Schedule
CagriSema37 residues (approx.)KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTYEach bubble = one amino acid. Size = residue mass. Color = chemical class.Uses closest standard amino acids for non-standard residues.

CagriSema

Weight LossInjectionPhase 3Grade B~7 days (semaglutide component ~158h; cagrilintide component ~184h) half-life
Amylin AnalogGLP-1 AgonistCombination TherapyWeight ManagementAppetite Regulation

Benefits

Average 22.7% body weight loss over 68 weeks (REDEFINE 1, treatment-policy estimate 20.4%)
Dual mechanism: amylin + GLP-1 targets two separate satiety pathways
Superior weight loss compared to semaglutide alone (22.7% vs 16.1%)
Approximately 40% of patients achieved 25% or more weight loss
Significant HbA1c reduction in patients with type 2 diabetes
Once-weekly dosing with a single pre-filled pen injection
Improved cardiometabolic markers including blood pressure and lipids
Half-Life
~7 days
Route
Injection
Frequency
Weekly
Vial Sizes
3mg
BAC Water
Pre-filled
Safety Grade
Grade B
Open CagriSema Dosage Calculator
Calculate exact syringe units for your vial and dose

About CagriSema

CagriSema is a first-in-class, fixed-dose combination of cagrilintide (a long-acting amylin analog) and semaglutide (a GLP-1 receptor agonist) developed by Novo Nordisk. By targeting two distinct appetite-regulating pathways — amylin and GLP-1 — in a single weekly injection, CagriSema produces greater weight loss than either component alone. In the Phase 3 REDEFINE 1 trial, participants without diabetes lost an average of 22.7% of their body weight over 68 weeks, with roughly 40% achieving at least 25% weight loss. REDEFINE 2 demonstrated 15.7% weight loss in adults with type 2 diabetes. Novo Nordisk has submitted an NDA to the FDA, positioning CagriSema as the next generation of obesity treatment.

Who Should Consider CagriSema

  • Adults with BMI ≥30 (obesity)
  • Adults with BMI ≥27 with at least one weight-related comorbidity
  • Adults with obesity or overweight and type 2 diabetes
  • Patients who have plateaued on GLP-1 monotherapy
  • Individuals seeking greater weight loss than single-agent options

How CagriSema Works

CagriSema combines two complementary appetite-regulating mechanisms in a fixed-dose formulation. Cagrilintide is a long-acting analog of amylin, a hormone co-secreted with insulin from pancreatic beta cells. It activates amylin receptors (calcitonin receptor + RAMP complexes) in the area postrema and hypothalamus, reducing food intake by promoting early satiety and slowing gastric emptying. Semaglutide is a GLP-1 receptor agonist that mimics incretin signaling — it enhances glucose-dependent insulin secretion, suppresses glucagon release, slows gastric emptying, and activates hypothalamic satiety centers. Together, these two pathways produce additive appetite suppression and greater weight loss than either agent alone, as confirmed by the REDEFINE 1 head-to-head comparison arms.

What to Expect

Weeks 1-4
0.25 mg/0.25 mg

Initial titration phase. GI side effects (nausea, constipation) most common early. Mild appetite reduction may begin. Body adapts to dual amylin + GLP-1 activation.

Weeks 5-8
0.5 mg/0.5 mg

Appetite suppression becomes more noticeable. Early weight loss of 2-5% expected. Nausea typically starts to subside as the dose stabilizes.

Weeks 9-16
1.0-1.7 mg/1.0-1.7 mg

Continued titration with progressive appetite and hunger reduction. Steady weight loss accelerates. Blood glucose and insulin sensitivity improve in those with type 2 diabetes.

Weeks 17-68
2.4 mg/2.4 mg maintenance

Full therapeutic dose. REDEFINE 1 showed 22.7% mean weight loss by week 68 (treatment-policy: 20.4%). About 40% of patients reached ≥25% loss and 23% reached ≥30%. GI side effects largely resolved.

Week 68+

Long-term maintenance at reduced body weight. Continued metabolic and cardiometabolic benefits expected while on therapy. Weight regain likely if treatment is stopped.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner0.5mgWeekly
Moderate1.7mgWeekly
Aggressive2.4mgWeekly

Note: Fixed-ratio combination of cagrilintide 2.4 mg + semaglutide 2.4 mg in a single pre-filled pen. Titrate over 16 weeks: 0.25 mg each (wk 1-4), 0.5 mg (wk 5-8), 1.0 mg (wk 9-12), 1.7 mg (wk 13-16), then 2.4 mg maintenance. Not yet FDA-approved — Phase 3 REDEFINE program ongoing. NDA submitted to FDA.

How to Inject CagriSema

Inject subcutaneously once weekly using the pre-filled pen, on the same day each week. Injection sites include the abdomen, thigh, or upper arm — rotate sites between injections. Can be taken at any time of day, with or without food. Follow the 16-week titration schedule: 0.25 mg/0.25 mg (weeks 1-4), 0.5 mg/0.5 mg (weeks 5-8), 1.0 mg/1.0 mg (weeks 9-12), 1.7 mg/1.7 mg (weeks 13-16), and 2.4 mg/2.4 mg maintenance from week 17 onward.

Cycling Protocol

On Period
68 weeks
Off Period
0 weeks

Based on 68-week REDEFINE Phase 3 trial design. Intended for long-term use. Weight regain expected upon discontinuation, consistent with GLP-1 agonist class. Titrate over 16 weeks before reaching maintenance dose.

Pharmacokinetics

Half-Life
168h
Bioavailability
SC: estimated ~65% (cagrilintide); ~89% (semaglutide)
Tmax
Cagrilintide: 24-72h; Semaglutide: 12-24h
Data Confidence
moderate

Source: Phase 1b trial (Enebo et al., Lancet 2021, PMID 33894838): semaglutide t½ 145-165h, cagrilintide t½ 159-195h

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Gastrointestinal events are the most common side effects, occurring in ~80% of participants (vs ~40% placebo). Nausea (55%), constipation (31%), vomiting (26%), and diarrhea are typical. Most GI effects are mild to moderate and diminish over time, especially with proper titration. Discontinuation due to adverse events was ~6% in REDEFINE 1. Injection site reactions may occur.

Contraindications

  • Personal or family history of medullary thyroid carcinoma (MTC)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN2)
  • History of pancreatitis
  • Pregnancy or breastfeeding
  • Known hypersensitivity to cagrilintide, semaglutide, or any excipients
  • Severe gastrointestinal disease (e.g., gastroparesis)
  • End-stage renal disease (insufficient data)

Drug Interactions

  • Insulin and sulfonylureas — increased hypoglycemia risk; dose adjustment may be needed
  • Oral medications — absorption may be delayed due to slowed gastric emptying from both components
  • Levothyroxine — monitor thyroid levels; GLP-1 agonists may alter exposure
  • Warfarin — monitor INR more frequently during initiation and dose changes
  • Oral contraceptives — delayed absorption possible due to gastric emptying effects; no confirmed clinical interaction but caution is advised

Storage & Stability

Before Reconstitution
N/A — supplied as pre-filled injection pen
After Reconstitution
N/A — no reconstitution required
Temperature
2-8°C (36-46°F); do not freeze

Molecular Profile

Amino Acids
37
Sequence
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. REDEFINE 1: Coadministered Cagrilintide and Semaglutide in Adults with Overweight or Obesity (NEJM 2025)PubMed 40544433
  2. REDEFINE 2: Cagrilintide-Semaglutide in Adults with Overweight or Obesity and Type 2 Diabetes (NEJM 2025)PubMed 40544432
  3. Phase 2 Trial: Cagrilintide 2.4 mg + Semaglutide 2.4 mg in Type 2 Diabetes (Lancet 2023)PubMed 37364590
  4. Phase 1b PK/PD: Cagrilintide + Semaglutide for Weight Management (Lancet 2021)PubMed 33894838
  5. Systematic Review and Meta-Analysis: Cagrilintide Alone and as CagriSema (Indian J Endocrinol Metab 2024)Review

Frequently Asked Questions