Peptide Schedule
Beta-Endorphin31 residuesYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGEEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Beta-Endorphin

CognitiveInjectionResearchGrade C~20-35 minutes (plasma); variable CNS half-life half-life
Endogenous OpioidPOMC-DerivedPain ModulationNeuroactive PeptideMu-Opioid AgonistStress ResponseMood Regulation4 weeks on / 4 weeks off

Benefits

Potent endogenous analgesic activity via mu-opioid receptor activation
Modulates stress response and promotes resilience to acute psychological and physical stress
Contributes to exercise-induced euphoria and improved mood states
Supports immune system regulation through natural killer cell and lymphocyte modulation
Participates in appetite and energy homeostasis regulation via hypothalamic circuits
May improve subjective well-being and reduce symptoms of depression in preclinical models
Serves as a critical research tool for understanding endogenous opioid system pharmacology
Half-Life
~20-35 minutes
Route
Injection
Frequency
EOD
Vial Sizes
1mg, 2mg
BAC Water
2mL
Safety Grade
Grade C
Open Beta-Endorphin Dosage Calculator
Calculate exact syringe units for your vial and dose

About Beta-Endorphin

Beta-endorphin is the principal endogenous opioid peptide of the human body, first isolated and characterized by Choh Hao Li and David Chung in 1976 from camel pituitary extracts. It comprises the 31-amino-acid C-terminal fragment (residues 237-267) of the 267-amino-acid precursor protein pro-opiomelanocortin (POMC), which also gives rise to ACTH, alpha-MSH, and other bioactive peptides through tissue-specific proteolytic processing. In the anterior pituitary, POMC cleavage by prohormone convertase 1 (PC1) yields ACTH and beta-lipotropin, with further cleavage of beta-lipotropin producing beta-endorphin. In the arcuate nucleus of the hypothalamus, additional processing by PC2 generates alpha-MSH and beta-endorphin that project widely throughout the central nervous system. Beta-endorphin binds mu-opioid receptors with nanomolar affinity (Ki approximately 1-3 nM) and delta-opioid receptors with somewhat lower affinity. It is considered the body's most powerful endogenous pain-relieving molecule, playing a central role in stress-induced analgesia, reward circuitry modulation, and neuroendocrine regulation. Plasma beta-endorphin levels rise dramatically during acute physical stress, intense exercise (the so-called "runner's high"), labor and delivery, and acute trauma. Cerebrospinal fluid levels correlate with analgesic states and mood regulation. Beyond pain modulation, beta-endorphin influences immune function by modulating natural killer cell activity and lymphocyte proliferation, regulates appetite through hypothalamic feeding circuits, and participates in the reward and reinforcement pathways that overlap with those activated by exogenous opioids. Dysregulation of the beta-endorphin system has been implicated in conditions including chronic pain syndromes, major depression, addiction, obesity, and fibromyalgia. As an exogenous therapeutic agent, beta-endorphin remains in the preclinical and research-only phase. Its rapid enzymatic degradation by aminopeptidases and enkephalinases in plasma limits peripheral bioavailability, and the blood-brain barrier restricts CNS access from systemic administration. Research interest focuses on understanding its physiological roles, developing stabilized analogs, and exploring potential applications in pain management and mood disorders.

Who Should Consider Beta-Endorphin

  • Pain researchers studying endogenous opioid mechanisms
  • Neuroscientists investigating reward and stress circuitry
  • Neuroendocrinology researchers studying POMC processing
  • Immunologists exploring opioid-immune interactions
  • Exercise physiologists studying runner's high mechanisms

How Beta-Endorphin Works

Beta-endorphin exerts its primary biological effects through high-affinity agonism at the mu-opioid receptor (MOR), with secondary activity at delta-opioid receptors (DOR). Upon binding to MOR, beta-endorphin activates Gi/Go heterotrimeric G-proteins, initiating three principal downstream signaling cascades: inhibition of adenylyl cyclase resulting in decreased intracellular cyclic AMP (cAMP) levels, closure of voltage-gated N-type calcium channels which reduces presynaptic neurotransmitter release, and activation of G-protein-coupled inwardly rectifying potassium channels (GIRKs) causing membrane hyperpolarization. These combined effects suppress nociceptive signal propagation at both spinal dorsal horn synapses and supraspinal relay centers. In the periaqueductal gray (PAG) and rostral ventromedial medulla (RVM), beta-endorphin disinhibits descending pain-inhibitory circuits by suppressing tonically active GABAergic interneurons, thereby amplifying serotonergic and noradrenergic analgesic output to the spinal cord. Beyond pain modulation, beta-endorphin released from arcuate nucleus POMC neurons acts on mu-opioid receptors in the ventral tegmental area (VTA) to modulate dopaminergic reward signaling in the nucleus accumbens, contributing to reward processing and stress resilience. Beta-endorphin also modulates immune function by binding mu-opioid receptors expressed on T-lymphocytes, B-cells, and natural killer cells, influencing cytokine release profiles and cellular immune responses. The peptide undergoes signal termination primarily through enzymatic degradation by aminopeptidase N and enkephalinase (neprilysin/CD10), with a plasma half-life of approximately 20-35 minutes.

What to Expect

0-15 minutes

Rapid onset of analgesic and mild euphoric effects following IV administration in preclinical models

15-60 minutes

Peak plasma concentration reached; maximal analgesic response and measurable HPA axis modulation

1-4 hours

Gradual decline of analgesic effect as peptide is enzymatically degraded; secondary immune modulation effects may persist

1-2 weeks

With repeated intermittent dosing, potential cumulative effects on mood and stress response observed in animal models

4+ weeks

Risk of tolerance development increases; monitoring for reduced analgesic efficacy and rebound hyperalgesia recommended

Dosing Protocol

LevelDose / InjectionFrequency
Beginner100mcgEOD
Moderate250mcgEOD
Aggressive500mcgDaily

Note: Beta-endorphin is a 31-amino-acid endogenous opioid neuropeptide (sequence: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu) cleaved from the C-terminal fragment of pro-opiomelanocortin (POMC). It is the most potent endogenous analgesic produced by the human body, with approximately 18-33 times the analgesic potency of morphine on a molar basis. Beta-endorphin binds preferentially to mu-opioid receptors but also interacts with delta-opioid receptors. It is synthesized primarily in the anterior pituitary gland and arcuate nucleus of the hypothalamus and released into both the bloodstream and cerebrospinal fluid during stress, pain, and vigorous exercise. Exogenous administration remains strictly investigational. This entry is for research and educational reference only.

How to Inject Beta-Endorphin

Beta-endorphin is supplied as a lyophilized powder and should be reconstituted with bacteriostatic water. Add the appropriate volume of bacteriostatic water slowly along the vial wall, then gently swirl until fully dissolved — do not shake or vortex, as this may damage the peptide structure. For subcutaneous administration, inject into the abdominal or upper thigh region using a 29-31 gauge insulin syringe. Rotate injection sites to prevent tissue irritation. Intravenous administration should only be performed in controlled research or clinical settings with appropriate monitoring equipment. Due to the rapid enzymatic degradation of beta-endorphin in plasma, subcutaneous administration provides a slower absorption profile that may partially offset the short plasma half-life. Store reconstituted solution at 2-8°C and use within 14 days. All handling should follow standard peptide research safety protocols.

Cycling Protocol

On Period
4 weeks
Off Period
4 weeks

Due to limited human clinical data, cycling recommendations are extrapolated from general opioid peptide pharmacology. Conservative protocols suggest a maximum of 4 weeks of intermittent use followed by an equal off period to minimize the risk of tolerance development and HPA axis suppression. Monitoring of mood, pain sensitivity, and endocrine markers is recommended during and after the on-cycle. Abrupt cessation after prolonged use may produce rebound effects.

Pharmacokinetics

Half-Life
27min
Bioavailability
SC: estimated 40-60%; limited by rapid aminopeptidase degradation
Tmax
IV: immediate; SC: ~15-30 minutes
Data Confidence
moderate

Source: Foley et al., 1979 — plasma elimination studies in humans following IV infusion

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

As an endogenous opioid peptide, exogenous beta-endorphin administration carries mu-opioid receptor-mediated side effects similar to other opioids, though the clinical profile in humans is not well characterized due to limited research-only use. Reported and anticipated adverse effects include dose-dependent respiratory depression, sedation and drowsiness, nausea and vomiting, constipation and reduced gastrointestinal motility, miosis, bradycardia, and mild hypotension. At higher doses, significant CNS depression may occur. Repeated exogenous administration carries a theoretical risk of tolerance development and physical dependence, though this has not been systematically studied in humans. Pruritus (itching) at the injection site and mild flushing have been observed in limited research settings. Beta-endorphin may suppress the hypothalamic-pituitary-adrenal (HPA) axis with repeated dosing, potentially reducing endogenous cortisol and ACTH release. Paradoxical hyperalgesia following cessation of exogenous dosing is a theoretical concern based on opioid pharmacology. Individuals with a history of opioid use disorder should be considered at elevated risk for adverse psychological responses.

Contraindications

  • History of opioid use disorder or substance abuse
  • Concurrent use of CNS depressants including benzodiazepines, barbiturates, or alcohol
  • Severe respiratory insufficiency or obstructive pulmonary disease
  • Known hypersensitivity to endogenous opioid peptides or excipients
  • Pregnancy and breastfeeding due to potential neuroendocrine effects on the fetus or infant

Drug Interactions

  • Opioid agonists and partial agonists (additive respiratory depression and sedation risk)
  • Benzodiazepines and other GABAergic sedatives (synergistic CNS depression)
  • Naloxone and naltrexone (complete antagonism of beta-endorphin effects)
  • MAO inhibitors (potential for unpredictable enhancement of opioid-mediated effects)
  • Corticosteroids (may alter POMC processing and endogenous beta-endorphin levels)

Storage & Stability

Before Reconstitution
Up to 24 months at -20°C, desiccated, protected from light
After Reconstitution
Up to 14 days at 2-8°C; avoid repeated freeze-thaw cycles
Temperature
-20°C lyophilized; 2-8°C (36-46°F) reconstituted

Molecular Profile

Amino Acids
31
Sequence
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. beta-Endorphin: a review of its properties and clinical significanceReview
  2. Isolation and structure of beta-endorphin from camel pituitary glandsPubMed 1062023
  3. Exercise and the endogenous opioids: beta-endorphin and the runner's highReview
  4. Pro-opiomelanocortin processing in the hypothalamus: impact on melanocortin signalling and obesityReview
  5. Beta-endorphin modulates immune function: a reviewReview

Frequently Asked Questions