Peptide Schedule
Nesiritide (Natrecor)32 residuesSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRHEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Nesiritide (Natrecor)

Healing & RecoveryInjectionFDA ApprovedGrade B18 minutes half-life
BNPHeart FailureVasodilatorFDA-ApprovedNatriuretic Peptide

Benefits

Rapid reduction in pulmonary capillary wedge pressure (PCWP)
Balanced arterial and venous vasodilation
Decreased systemic vascular resistance and cardiac afterload
Improved cardiac output without direct inotropic stimulation
Promotes natriuresis and diuresis to relieve fluid overload
Reduction in right atrial pressure and cardiac preload
Improvement in dyspnea symptoms in acute decompensated heart failure
Half-Life
18 minutes
Route
Injection
Frequency
Single dose
Vial Sizes
1.5mg
BAC Water
Pre-filled
Safety Grade
Grade B
Open Nesiritide (Natrecor) Dosage Calculator
Calculate exact syringe units for your vial and dose

About Nesiritide (Natrecor)

Nesiritide (brand name Natrecor) is a recombinant human B-type natriuretic peptide (rhBNP) approved by the FDA in 2001 for the intravenous treatment of patients with acutely decompensated congestive heart failure who have dyspnea at rest or with minimal activity. The peptide has an identical amino acid sequence to the endogenous BNP produced by ventricular cardiomyocytes in response to myocardial wall stress and volume overload. Nesiritide binds to natriuretic peptide receptor-A (NPR-A) on vascular smooth muscle and endothelial cells, activating particulate guanylyl cyclase and increasing intracellular cyclic guanosine monophosphate (cGMP). This cGMP-mediated signaling cascade produces balanced arterial and venous vasodilation, reduces cardiac preload and afterload, and promotes natriuresis and diuresis. The net hemodynamic effect is a rapid reduction in pulmonary capillary wedge pressure (PCWP), right atrial pressure, and systemic vascular resistance, along with an increase in cardiac output without direct inotropic stimulation. The landmark VMAC trial (2002) demonstrated that nesiritide significantly reduced PCWP compared to IV nitroglycerin and placebo, and improved patient-reported dyspnea scores. The subsequent large-scale ASCEND-HF trial (2011, n=7,141) showed that nesiritide modestly improved dyspnea but did not reduce 30-day mortality or heart failure rehospitalization compared to placebo. Nesiritide is administered as a weight-based IV bolus of 2 mcg/kg followed by a continuous infusion at 0.01 mcg/kg/min for up to 48 hours in hospitalized settings. It is not recommended for outpatient or intermittent scheduled use. Common adverse effects include hypotension, headache, and potential worsening of renal function in susceptible patients. Despite its initial promise, clinical use has declined significantly following the ASCEND-HF results, though it remains FDA-approved and available for acute hemodynamic stabilization in selected patients.

Who Should Consider Nesiritide (Natrecor)

  • Hospitalized patients with acute decompensated heart failure
  • Patients with dyspnea at rest or with minimal activity
  • Heart failure patients requiring preload and afterload reduction
  • Patients unresponsive to initial standard heart failure therapy
  • Adults with elevated pulmonary capillary wedge pressure

How Nesiritide (Natrecor) Works

Nesiritide is a recombinant form of the endogenous 32-amino-acid human B-type natriuretic peptide (BNP). It binds to the transmembrane natriuretic peptide receptor-A (NPR-A), also known as guanylyl cyclase-A (GC-A), which is expressed on vascular smooth muscle cells, endothelial cells, renal cells, and adrenal tissue. Receptor activation stimulates the intracellular guanylyl cyclase domain, catalyzing conversion of GTP to cyclic guanosine monophosphate (cGMP). Elevated cGMP activates cGMP-dependent protein kinases (PKG), leading to smooth muscle relaxation in both arterial and venous beds through dephosphorylation of myosin light chains and reduced intracellular calcium. This produces balanced vasodilation that decreases both preload and afterload. In the kidneys, cGMP signaling enhances glomerular filtration and inhibits sodium reabsorption in the collecting ducts, promoting natriuresis and diuresis. Nesiritide also suppresses the renin-angiotensin-aldosterone system (RAAS) and reduces sympathetic nervous system activation, further contributing to hemodynamic improvement. The drug is cleared through three mechanisms: binding to NPR-C clearance receptors with subsequent lysosomal degradation, proteolytic cleavage by neutral endopeptidases (neprilysin), and renal filtration.

What to Expect

0-15 minutes

Onset of hemodynamic effects with reduction in PCWP and right atrial pressure following IV bolus

15-60 minutes

Significant decrease in systemic vascular resistance, reduction in dyspnea symptoms, and improved cardiac output

1-3 hours

Sustained hemodynamic improvement with peak vasodilatory and natriuretic effects during continuous infusion

3-48 hours

Maintained hemodynamic stabilization; continued monitoring for hypotension and renal function required

Post-infusion

Hemodynamic effects gradually resolve over approximately 60 minutes after discontinuation; systolic BP returns to baseline

Dosing Protocol

LevelDose / InjectionFrequency
Beginner1mcgSingle dose
Moderate2mcgSingle dose
Aggressive2mcgSingle dose

Note: Nesiritide (Natrecor) is a recombinant form of human B-type natriuretic peptide (BNP) identical to the endogenous 32-amino-acid peptide produced by the ventricular myocardium in response to volume overload and increased wall stress. It is FDA-approved exclusively for IV use in hospitalized patients with acutely decompensated heart failure who have dyspnea at rest or with minimal activity. The recommended regimen is a 2 mcg/kg IV bolus over 60 seconds followed by a continuous infusion at 0.01 mcg/kg/min. Nesiritide should not be used as a substitute for diuretics and must be administered under hemodynamic monitoring. The ASCEND-HF trial (2011) showed nesiritide did not reduce mortality or rehospitalization versus placebo but did modestly improve dyspnea. It is not intended for outpatient, intermittent, or scheduled repetitive use.

How to Inject Nesiritide (Natrecor)

Nesiritide is administered exclusively by intravenous infusion in a monitored hospital setting. Reconstitute one 1.5 mg vial by adding 5 mL of diluent (D5W, 0.9% NaCl, or 5% dextrose with 0.2% NaCl) removed from a pre-filled 250 mL IV bag, yielding a concentration of 0.32 mg/mL. Gently rock the vial — do not shake. Withdraw the entire reconstituted contents and add back to the 250 mL IV bag for a final concentration of approximately 6 mcg/mL. The recommended dose is a 2 mcg/kg IV bolus administered over approximately 60 seconds, followed immediately by a continuous infusion at 0.01 mcg/kg/min. Monitor blood pressure closely; if systolic BP drops below 90 mmHg, reduce or discontinue the infusion. Do not initiate at higher than recommended doses. Infusion duration is typically up to 48 hours. Do not co-administer through the same IV line with heparin, insulin, furosemide, or hydralazine.

Cycling Protocol

On Period
0 weeks
Off Period
0 weeks

Nesiritide is used exclusively for acute treatment of decompensated heart failure in hospitalized settings, typically as a single continuous infusion lasting up to 48 hours. It is not cycled and is not intended for outpatient, intermittent, or scheduled repetitive use.

Pharmacokinetics

Half-Life
18min
Bioavailability
100% (intravenous administration)
Tmax
Immediate (IV bolus)
Data Confidence
high

Source: FDA label: mean terminal elimination half-life ~18 minutes

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

The most clinically significant adverse effect of nesiritide is symptomatic hypotension, occurring in approximately 4% of patients at the recommended dose. Blood pressure should be monitored closely, and the infusion should be reduced or discontinued if systolic BP falls below 90 mmHg. Headache is the most common non-cardiovascular side effect. Other reported adverse effects include nausea, vomiting, dizziness, anxiety, insomnia, abdominal pain, and back pain. Ventricular tachycardia has been observed in approximately 3% of patients. Nesiritide may worsen renal function in susceptible individuals, particularly those with severe heart failure whose renal perfusion depends on the renin-angiotensin-aldosterone system. Elevated serum creatinine has been observed, especially at doses exceeding the recommended infusion rate. Allergic reactions and anaphylaxis are rare but possible. Dose-dependent hypotension is the primary dose-limiting toxicity.

Contraindications

  • Hypersensitivity to nesiritide or any component of the formulation
  • Cardiogenic shock or systolic blood pressure below 90 mmHg used as primary therapy
  • Significant valvular stenosis, restrictive or obstructive cardiomyopathy
  • Constrictive pericarditis or pericardial tamponade
  • Conditions where cardiac output is dependent on venous return
  • Pregnancy — FDA Category C; use only if potential benefit justifies risk to fetus
  • Breastfeeding — unknown whether nesiritide is excreted in human milk; use with caution in nursing mothers

Drug Interactions

  • ACE inhibitors — increased risk of symptomatic hypotension when combined with nesiritide
  • IV heparin — physical incompatibility; do not co-administer through the same IV line
  • IV furosemide — physical incompatibility; do not co-administer through the same IV line
  • Insulin and hydralazine — physical incompatibility via same IV catheter
  • Other vasodilators and antihypertensives — additive hypotensive effects requiring close monitoring

Storage & Stability

Before Reconstitution
Store below 25°C (77°F). Do not freeze. Keep in outer carton to protect from light.
After Reconstitution
Stable for up to 24 hours at 2-25°C (36-77°F). Contains no antimicrobial preservative — use within 24 hours.
Temperature
2-25°C (36-77°F)

Molecular Profile

Amino Acids
32
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Intravenous nesiritide vs nitroglycerin for treatment of decompensated congestive heart failure: a randomized controlled trial (VMAC)PubMed 11911755
  2. Acute Study of Clinical Effectiveness of Nesiritide in Decompensated Heart Failure (ASCEND-HF)PubMed 21732835
  3. NATRECOR (nesiritide) FDA Prescribing InformationFDA Label

Frequently Asked Questions