Peptide Schedule
Lixisenatide44 residuesHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSKKKKKKEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Lixisenatide

Weight LossInjectionFDA ApprovedGrade A~3 hours half-life
GLP-1 AgonistShort-ActingExendin-4 DerivativeType 2 DiabetesPostprandial GlucoseFDA-ApprovedPre-Filled PenSoliqua Combination

Benefits

FDA-approved for glycemic control in type 2 diabetes with established safety profile
Strong postprandial glucose reduction — particularly effective for the meal taken after injection
HbA1c reduction of 0.5-1.0% across the GetGoal Phase III trial program
Modest weight loss of 0.4-2.7 kg (does not cause weight gain like some diabetes therapies)
Cardiovascular safety confirmed in the ELIXA trial (6,068 patients, median 25-month follow-up)
Simple once-daily pre-filled pen injection with straightforward 14-day titration
Available as Soliqua fixed-ratio combination with insulin glargine for dual fasting and postprandial control
Four-fold higher GLP-1 receptor binding affinity compared to native GLP-1
Half-Life
~3 hours
Route
Injection
Frequency
Daily
Vial Sizes
10mg, 20mg
BAC Water
Pre-filled
Safety Grade
Grade A
Open Lixisenatide Dosage Calculator
Calculate exact syringe units for your vial and dose

About Lixisenatide

Lixisenatide is a 44-amino-acid synthetic peptide derived from exendin-4, a compound originally isolated from the saliva of the Gila monster (Heloderma suspectum). Like exenatide, it is built on the exendin-4 backbone but with key structural modifications: deletion of a proline at position 38 and addition of six lysine residues at the C-terminus. These changes give it a four-fold higher binding affinity for the GLP-1 receptor compared to native human GLP-1. Sanofi developed lixisenatide and received EU marketing authorization (as Lyxumia) in 2013, followed by FDA approval (as Adlyxin) in July 2016. It was classified as a short-acting GLP-1 receptor agonist based on its approximately 3-hour half-life, which distinguishes it from long-acting agents like semaglutide and dulaglutide. This short duration of action gives it a particularly strong effect on postprandial glucose — especially after the meal closest to injection — rather than round-the-clock GLP-1 receptor activation. The GetGoal clinical trial program (11 Phase III trials) established its efficacy across the type 2 diabetes spectrum. As monotherapy or add-on to oral agents or basal insulin, lixisenatide consistently reduced HbA1c by 0.5-1.0% and produced modest weight loss of 0.4-2.7 kg. The ELIXA cardiovascular outcomes trial (6,068 patients with recent acute coronary syndrome) confirmed cardiovascular safety — it neither increased nor decreased major cardiac events (HR 1.02, 95% CI 0.89-1.17). In 2017, the FDA approved Soliqua 100/33, a fixed-ratio combination of insulin glargine and lixisenatide in a single pen. This combination targets both fasting glucose (via basal insulin) and postprandial spikes (via lixisenatide) and showed superior HbA1c reduction compared to either component alone in the LixiLan trial program. While standalone Adlyxin was discontinued in the US in January 2023, Soliqua remains commercially available.

Who Should Consider Lixisenatide

  • Adults with type 2 diabetes inadequately controlled on oral antidiabetic agents
  • Patients on basal insulin needing postprandial glucose control (as Soliqua combination)
  • Type 2 diabetics who prefer a simple once-daily injection with short titration
  • Patients with cardiovascular disease history (ELIXA-confirmed safety profile)
  • Those who want modest weight loss without the intensity of long-acting GLP-1 agonists

How Lixisenatide Works

Lixisenatide is a selective GLP-1 receptor agonist that mimics the incretin hormone glucagon-like peptide-1. It binds to the GLP-1 receptor on pancreatic beta cells with approximately four-fold greater affinity than native GLP-1, activating Gs-protein-coupled signaling cascades that increase intracellular cyclic AMP (cAMP). This produces several glucose-dependent effects: stimulation of insulin secretion when blood glucose is elevated, suppression of glucagon release from alpha cells, and delayed gastric emptying that slows nutrient absorption. As a short-acting GLP-1 agonist (half-life ~3 hours), lixisenatide produces transient but pronounced GLP-1 receptor activation rather than continuous stimulation. This pharmacokinetic profile explains its disproportionately strong effect on postprandial glucose compared to fasting glucose — the drug reaches peak concentration around the time of the post-injection meal and substantially slows gastric emptying during that window. Long-acting GLP-1 agonists like semaglutide cause tachyphylaxis of the gastric emptying effect over time, while lixisenatide maintains this effect because receptor occupancy is intermittent. Structurally, lixisenatide is derived from exendin-4 (the peptide found in Gila monster venom) with modifications at the C-terminus: deletion of proline-38 and addition of six lysine residues. These changes confer resistance to degradation by dipeptidyl peptidase-4 (DPP-4), the enzyme that rapidly inactivates native GLP-1 within 1-2 minutes. Lixisenatide is eliminated primarily through glomerular filtration and proteolytic degradation in the kidneys.

What to Expect

Days 1-14

Starting dose of 10 mcg daily. Appetite suppression begins. Nausea is most common during this initiation phase and typically mild. Postprandial glucose improvements are noticeable within the first few days, especially after the meal following injection.

Days 15-30

Dose increase to 20 mcg daily. Stronger postprandial glucose control. GI side effects may briefly recur with the dose increase but usually resolve within a week. Early HbA1c improvements beginning.

Weeks 5-12

Steady-state therapeutic effect. HbA1c reductions of 0.5-0.8% typically measurable. Modest weight loss of 1-2 kg. Nausea and other GI effects largely resolved by this point.

Weeks 12-24

Full therapeutic benefit reached. HbA1c reduction of 0.5-1.0% from baseline across GetGoal trials. Weight stable or modestly lower (0.4-2.7 kg loss depending on background therapy). Postprandial glucose control well established.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner10mcgDaily
Moderate20mcgDaily
Aggressive20mcgDaily

Note: Lixisenatide (brand names: Adlyxin in the US, Lyxumia in the EU) is an FDA-approved short-acting GLP-1 receptor agonist for type 2 diabetes. It is a pre-filled pen — no reconstitution needed. Start at 10 mcg SC once daily for 14 days, then increase to 20 mcg once daily. Inject within one hour before the first meal of the day. Also available as Soliqua 100/33 (fixed-ratio combination with insulin glargine). Note: Adlyxin was discontinued in the US market as of January 1, 2023, though Soliqua remains available.

How to Inject Lixisenatide

Lixisenatide is supplied as a pre-filled, disposable pen in two strengths: a green starter pen (10 mcg/dose, 14 doses) and a burgundy maintenance pen (20 mcg/dose, 14 doses). No reconstitution or mixing is required. Inject subcutaneously in the abdomen, thigh, or upper arm once daily within 60 minutes before the first meal of the day. Rotate injection sites. Titration: use the 10 mcg starter pen for 14 days, then switch to the 20 mcg maintenance pen on day 15. Attach a new needle before each injection. Remove the needle after use and store the pen without a needle attached. Discard the pen 14 days after first use. If a dose is missed, inject within 60 minutes before the next meal.

Cycling Protocol

On Period
52 weeks
Off Period
0 weeks

Intended for continuous daily use as a chronic diabetes therapy. No cycling protocol needed. If therapy is interrupted for more than 14 days, restart with 10 mcg daily for 14 days before returning to 20 mcg maintenance dose.

Pharmacokinetics

Half-Life
3h
Bioavailability
SC: ~55% plasma protein binding; absolute bioavailability not formally reported for SC route
Tmax
1-3.5 hours (median)
Data Confidence
high

Source: FDA prescribing information; mean terminal half-life ~3 hours after multiple-dose SC administration

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Gastrointestinal side effects are the most common and are consistent with the GLP-1 receptor agonist class. In pooled clinical trial data: nausea (25% vs 10% placebo), vomiting (10% vs 2% placebo), diarrhea (10% vs 8% placebo), and headache (8% vs 11% placebo). These GI effects are typically transient and tend to improve within the first 2-4 weeks. Symptomatic hypoglycemia occurred in about 9% of patients (vs 8% placebo) — risk increases when combined with sulfonylureas or insulin. Injection site reactions were reported in about 3.9% of patients. Rare but serious risks include pancreatitis (21 cases vs 14 in controls across all trials), acute kidney injury from dehydration during severe GI episodes, and allergic reactions including anaphylaxis. Unlike some other GLP-1 agonists, lixisenatide does not carry a boxed warning for thyroid C-cell tumors. Anti-lixisenatide antibodies developed in approximately 70% of patients but did not appear to affect efficacy or safety in most cases.

Contraindications

  • Known hypersensitivity to lixisenatide or any excipient in the formulation
  • Personal or family history of medullary thyroid carcinoma (precautionary — no boxed warning)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN2)
  • History of pancreatitis or active pancreatic disease
  • Severe gastrointestinal disease including gastroparesis
  • End-stage renal disease (eGFR <15 mL/min) or dialysis — limited data and renal elimination pathway
  • Pregnancy and breastfeeding (no adequate human data; animal studies showed adverse fetal effects)
  • Type 1 diabetes or diabetic ketoacidosis (not studied, not indicated)
  • Concurrent use with other GLP-1 receptor agonists

Drug Interactions

  • Sulfonylureas and insulin — increased risk of hypoglycemia; consider dose reduction of the secretagogue when adding lixisenatide
  • Oral contraceptives — take at least 1 hour before or 11 hours after lixisenatide injection due to delayed gastric emptying
  • Acetaminophen — delayed absorption and reduced peak concentration; clinical significance varies by indication
  • Narrow therapeutic index oral medications (warfarin, digoxin, levothyroxine) — monitor closely as gastric emptying delay may alter absorption kinetics
  • Antibiotics requiring threshold concentrations — consider timing relative to lixisenatide injection for drugs needing rapid absorption
  • Does not inhibit or induce cytochrome P450 enzymes — no significant CYP-mediated interactions expected

Storage & Stability

Before Reconstitution
Not applicable — pre-filled pen product
After Reconstitution
Not applicable — pre-filled pen, ready to use
Temperature
2-8°C (36-46°F) before first use; after first use, store at room temperature below 30°C (86°F) for up to 14 days

Molecular Profile

Amino Acids
44
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSKKKKKK
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. ELIXA — Lixisenatide in Patients with Type 2 Diabetes and Acute Coronary Syndrome (NEJM)PubMed 26630143
  2. GetGoal-L — Lixisenatide Add-On to Basal Insulin (Diabetes Care)PubMed 23628617
  3. Lixisenatide: A Once-Daily Incretin Mimetic Injection for Type-2 Diabetes (P&T)PubMed 29089722
  4. Lixisenatide, a Novel GLP-1 Receptor Agonist: Efficacy, Safety and Clinical ImplicationsPubMed 24373190
  5. The Clinical Development Program of Lixisenatide (Diabetes Ther)PubMed 25119443
  6. FDA Label — Adlyxin (lixisenatide) Prescribing InformationFDA Label

Frequently Asked Questions