Peptide Schedule
IGF-1 DES67 residuesTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSAEach bubble = one amino acid. Size = residue mass. Color = chemical class.

IGF-1 DES

Growth HormoneInjectionResearchGrade C~20-30 minutes half-life
IGF-1 AnalogSite-Specific GrowthMuscle HyperplasiaGrowth FactorAnabolic4 weeks on / 4 weeks off

Benefits

Site-specific muscle growth when injected locally post-workout
Approximately 10x more potent than native IGF-1
Promotes muscle hyperplasia (new muscle fiber creation)
Short half-life limits prolonged systemic exposure
Stimulates satellite cell proliferation and differentiation
Supports localized tissue repair and recovery
Half-Life
~20-30 minutes
Route
Injection
Frequency
Daily
Vial Sizes
0.1mg, 1mg
BAC Water
1mL
Safety Grade
Grade C
Open IGF-1 DES Dosage Calculator
Calculate exact syringe units for your vial and dose

About IGF-1 DES

IGF-1 DES (des(1-3) Insulin-like Growth Factor-1) is a 67-amino acid truncated analog of IGF-1, missing the first three N-terminal amino acids (Gly-Pro-Glu). This structural modification eliminates binding to all six IGF binding proteins (IGFBPs), meaning the entire dose remains bioactive in free form. The result is roughly 10-fold greater potency than native IGF-1, but with a half-life of only 20-30 minutes. This rapid clearance makes IGF-1 DES uniquely suited for localized intramuscular injection, allowing site-specific muscle hypertrophy and hyperplasia without prolonged systemic IGF-1 elevation. It activates the IGF-1 receptor (IGF-1R) and downstream PI3K/Akt/mTOR and MAPK/ERK signaling to drive protein synthesis, satellite cell proliferation, and new muscle fiber formation.

Who Should Consider IGF-1 DES

  • Experienced peptide users seeking localized muscle growth in lagging body parts
  • Advanced athletes with prior IGF-1 or growth hormone experience
  • Individuals researching site-specific anabolic signaling and muscle hyperplasia
  • Adults recovering from localized muscle injuries (under medical supervision)
  • Researchers studying IGF-1R activation independent of IGFBP modulation

How IGF-1 DES Works

IGF-1 DES binds and activates the IGF-1 receptor (IGF-1R) with equal affinity to native IGF-1 but without sequestration by IGF binding proteins. The deletion of the N-terminal tripeptide Gly-Pro-Glu removes the primary IGFBP recognition site, allowing 100% of the administered dose to remain in free, bioactive form. Upon receptor binding, IGF-1R undergoes autophosphorylation and recruits IRS-1 (insulin receptor substrate-1), activating two principal signaling cascades. The PI3K/Akt/mTOR pathway drives protein synthesis through phosphorylation of p70S6K and 4E-BP1, directly increasing translation of muscle-specific mRNAs. Simultaneously, the MAPK/ERK pathway promotes satellite cell proliferation — the mechanism behind muscle hyperplasia rather than just hypertrophy. Because IGFBPs normally sequester 95-98% of circulating IGF-1, the DES variant bypasses this buffer entirely, producing a potent but transient anabolic signal at the injection site. The short half-life (~20-30 minutes) means that local tissue exposure is high while systemic levels return to baseline quickly, reducing off-target growth stimulation in organs and other tissues.

What to Expect

Days 1-3

Initial blood glucose fluctuations may occur. Mild pump sensation in injected muscles reported within the first session. Injection site soreness or redness possible. Establish post-workout timing and blood sugar management routine.

Weeks 1-2

Increased muscle fullness and pumps in injected muscle groups during and after training. Temporary water retention around injection sites. Appetite changes and mild hypoglycemia episodes if carb intake is not managed.

Weeks 3-4

Measurable improvements in injected muscle group size and recovery speed. Localized growth effects become visible in trained and injected areas. Peak response window for satellite cell activation and new fiber formation.

Weeks 5-6
extended cycle

Continued but potentially diminishing returns as IGF-1R sensitivity decreases. Cycle off after 4-6 weeks. Gains in muscle density and localized size should be retained with consistent training through the off period.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner50mcgDaily
Moderate80mcgDaily
Aggressive120mcgDaily

Note: Truncated IGF-1 analog missing first 3 amino acids (des(1-3)IGF-1). Does not bind IGF binding proteins, giving it ~10x greater potency than native IGF-1 but a very short half-life. Inject intramuscularly into the target muscle immediately post-workout for site-specific growth. Use insulin syringes for accurate dosing. Monitor blood sugar closely.

How to Inject IGF-1 DES

Inject intramuscularly into the target muscle group immediately after training (within 15 minutes post-workout). Use a 29-31 gauge insulin syringe. Split bilateral doses between left and right sides of the muscle group being trained. Rotate between muscle groups based on training split. Consume fast-acting carbohydrates within 15 minutes of injection to counter potential hypoglycemia. Do not inject into the same muscle site more than 2-3 times per week.

Cycling Protocol

On Period
4 weeks
Off Period
4 weeks

Short cycles of 4-6 weeks are standard due to potential IGF-1R desensitization with prolonged use. Some protocols use only on training days (3-5 days per week) to extend cycle duration while minimizing total exposure. Allow a full 4-week off period between cycles to restore receptor sensitivity.

Pharmacokinetics

Half-Life
25min
Bioavailability
IM: ~100% bioactive (no IGFBP sequestration); SC: ~100% absorption but slower onset
Tmax
5-10 minutes (IM injection)
Data Confidence
moderate

Source: Estimated 20-30 min based on near-zero IGFBP affinity vs native IGF-1 (bound t½ ~12-15h, free t½ ~10 min); Francis et al. 1988 PMID 2454805, Ballard et al. 1996 PMID 8930132

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Hypoglycemia (low blood sugar) — always have fast-acting carbs available. Injection site redness, swelling, or irritation. Mild headaches. Water retention and joint discomfort at higher doses. Potential for localized tissue overgrowth with chronic use at the same site.

Contraindications

  • Active or history of any malignancy — IGF-1R activation may accelerate tumor cell proliferation
  • Pregnancy or breastfeeding — no safety data available; stimulates cell growth pathways
  • Type 1 diabetes or poorly controlled type 2 diabetes — high risk of severe hypoglycemia
  • Individuals under 18 or with open growth plates — may cause disproportionate skeletal growth
  • Known hypersensitivity to IGF-1 or related growth factor peptides
  • Active acromegaly or elevated baseline IGF-1 levels
  • Diabetic retinopathy — IGF-1 may worsen retinal neovascularization

Drug Interactions

  • Insulin — significantly increased hypoglycemia risk; concurrent use requires intensive glucose monitoring and dose reduction
  • Sulfonylureas and other oral hypoglycemic agents — additive blood sugar lowering; monitor glucose closely
  • Growth hormone (HGH) — synergistic IGF-1 axis stimulation; amplifies both anabolic effects and side effects including water retention and glucose dysregulation
  • IGF-1 LR3 — combining short-acting and long-acting IGF-1 analogs may cause excessive receptor stimulation and prolonged hypoglycemia
  • GLP-1 receptor agonists (semaglutide, tirzepatide) — both affect glucose homeostasis; increased hypoglycemia risk
  • Corticosteroids — may blunt IGF-1 anabolic effects through catabolic opposition and impaired protein synthesis

Storage & Stability

Before Reconstitution
Stable at room temperature for up to 30 days; refrigerated at 2-8°C for up to 24 months
After Reconstitution
Refrigerate at 2-8°C, use within 2-3 weeks. Do not freeze.
Temperature
2-8°C (36-46°F) after reconstitution

Molecular Profile

Amino Acids
67
Sequence
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Des-(1-3)IGF-I: a truncated form of insulin-like growth factor-I — structure, biological activity, binding proteins (Int J Biochem Cell Biol, 1995)Review
  2. IGF-I and the truncated analogue des-(1-3)IGF-I enhance growth in rats after gut resection (J Endocrinol, 1992)PubMed 1996625
  3. Serum half-life and biological activity of mutants of human insulin-like growth factor I which do not bind to serum binding proteins (Endocrinology, 1988)PubMed 2454805
  4. Use of Growth Hormone, IGF-I, and Insulin for Anabolic Purpose: Pharmacological Basis, Methods of Detection, and Adverse Effects (Endocr Rev, 2017)Review
  5. Mechanisms of IGF-1-Mediated Regulation of Skeletal Muscle Hypertrophy and Atrophy (Cells, 2020)Review
  6. IGF-I, IGFBP-3, and cancer risk: systematic review and meta-regression analysis (Lancet, 2004)PubMed 15110491

Frequently Asked Questions