Peptide Schedule
Mazdutide32 residuesHQGTFTSDYSKYLDEKKAKEFVEWLLEGGSSGEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Mazdutide

Weight LossInjectionPhase 3Grade C~6-7 days half-life
GLP-1 AgonistGlucagon AgonistDual AgonistWeight ManagementMetabolic Health

Benefits

Dual-action: appetite suppression + thermogenic fat burning
Long-acting weekly dosing
High-concentration vials for extended use
Improves metabolic markers
Significant weight loss in clinical trials
Half-Life
~6-7 days
Route
Injection
Frequency
Weekly
Vial Sizes
100mg
BAC Water
2mL
Safety Grade
Grade C
Open Mazdutide Dosage Calculator
Calculate exact syringe units for your vial and dose

About Mazdutide

Mazdutide is a dual-agonist peptide that activates both GLP-1 and glucagon receptors. The glucagon component adds thermogenic fat burning on top of GLP-1's appetite suppression. Available in high-concentration 100mg vials for extended protocols with less frequent vial changes. Clinical trials show significant weight loss with improvements in metabolic markers.

Who Should Consider Mazdutide

  • Adults with BMI ≥28 (or ≥24 with weight-related comorbidity, per Chinese guidelines)
  • Adults with type 2 diabetes inadequately controlled on metformin
  • Individuals seeking dual-mechanism weight loss beyond GLP-1-only therapy
  • Patients with obesity-related metabolic dysfunction (dyslipidemia, insulin resistance)

How Mazdutide Works

Mazdutide is an oxyntomodulin analogue that simultaneously activates GLP-1 and glucagon receptors. GLP-1 receptor activation suppresses appetite through hypothalamic signaling, slows gastric emptying to prolong satiety, and enhances glucose-dependent insulin secretion. Glucagon receptor activation increases hepatic energy expenditure and promotes fat oxidation, adding a thermogenic component that GLP-1-only drugs lack. This dual mechanism targets both sides of the energy balance equation — reduced intake and increased expenditure.

What to Expect

Weeks 1-4
3mg

Titration initiation. Mild appetite suppression begins. GI side effects (nausea, diarrhea, decreased appetite) are most common in this phase as the body adjusts to dual-receptor activation.

Weeks 5-8
3-6mg

Appetite suppression strengthens. Early weight loss of 3-5% is typical. GI side effects begin to ease for most users as dose escalates to 6mg.

Weeks 9-16
6mg

Steady weight loss continues. Blood glucose and lipid markers start improving. Most users experience 6-10% body weight reduction during this window.

Weeks 17-24
6-9mg

Escalation to full 9mg dose. Weight loss accelerates with the added thermogenic effect of glucagon activation. Phase 3 trials showed ~15% mean body weight loss by week 24.

Weeks 24-48
9mg maintenance

Full dose maintenance. GLORY-2 trial data showed up to 20.1% body weight loss at 48 weeks. Metabolic markers continue improving. Weight loss rate plateaus as a new equilibrium is established.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner3mgWeekly
Moderate6mgWeekly
Aggressive9mgWeekly

Note: Dual GLP-1/glucagon agonist. Titrate from 3mg weekly. Long-acting formula in high-concentration vials. Developed by Innovent Biologics.

How to Inject Mazdutide

Inject subcutaneously once weekly. Rotate injection sites between abdomen, thigh, and upper arm. Begin at 3mg weekly and titrate upward every 4 weeks (3mg → 6mg → 9mg) to reduce GI side effects. Administer at the same time each week.

Pharmacokinetics

Half-Life
168h
Bioavailability
SC: not yet formally reported
Tmax
24-72 hours
Data Confidence
moderate

Source: Phase 1b trial (NCT04440345), ~7 days

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Nausea, vomiting, diarrhea (common during titration). Decreased appetite. Injection site reactions.

Contraindications

  • Personal or family history of medullary thyroid carcinoma (MTC)
  • Multiple Endocrine Neoplasia syndrome type 2 (MEN2)
  • History of pancreatitis
  • Pregnancy or breastfeeding
  • Known hypersensitivity to mazdutide or any excipients
  • Severe gastrointestinal disease (e.g., gastroparesis)

Drug Interactions

  • Insulin and sulfonylureas — increased hypoglycemia risk due to combined glucose-lowering effects
  • Oral medications may have delayed absorption due to slowed gastric emptying
  • Levothyroxine — monitor thyroid levels as absorption timing may be altered
  • Warfarin — monitor INR more frequently during initiation and dose changes

Storage & Stability

Before Reconstitution
Refrigerate at 2-8°C
After Reconstitution
Refrigerate, use within 4 weeks
Temperature
2-8°C (36-46°F)

Molecular Profile

Amino Acids
32
Molecular Weight
4,813.45 Da
Sequence
HQGTFTSDYSKYLDEKKAKEFVEWLLEGGSSG
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Phase 2 RCT of Mazdutide in Chinese Overweight/Obese Adults (Nature Communications 2023)PubMed 38092790
  2. Efficacy and Safety of Mazdutide in Chinese Patients With Type 2 Diabetes — Phase 2 Trial (Diabetes Care 2024)PubMed 37943529
  3. Safety and Efficacy of Mazdutide (IBI362) 9mg and 10mg in Chinese Adults — Phase 1b Trial (eClinicalMedicine 2022)PubMed 36247927
  4. Once-Weekly Mazdutide in Chinese Adults with Obesity or Overweight — GLORY-1 Phase 3 (NEJM 2025)PubMed 40421736

Frequently Asked Questions