Peptide Schedule
CJC-1295 (DAC)30 residuesYDADIFTQSYRKVLAQLSARKLLQDILSRKEach bubble = one amino acid. Size = residue mass. Color = chemical class.

CJC-1295 (DAC)

Growth HormoneInjectionResearchGrade B~8 days half-life
Growth Hormone SecretagoguePerformance EnhancementBody RecompositionSleep Regulation12 weeks on / 4 weeks off

Benefits

Long-acting — only 1-2 injections per week
Sustained GH elevation for days
Promotes lean muscle growth
Enhances fat metabolism
Improves sleep quality and recovery
Half-Life
~8 days
Route
Injection
Frequency
Weekly
Vial Sizes
2mg, 5mg
BAC Water
2mL
Safety Grade
Grade B
Open CJC-1295 (DAC) Dosage Calculator
Calculate exact syringe units for your vial and dose

About CJC-1295 (DAC)

CJC-1295 with DAC (Drug Affinity Complex) is a long-acting growth hormone releasing hormone (GHRH) analog. The DAC modification allows it to bind to albumin in the blood, extending its half-life to about 8 days. This creates sustained, elevated growth hormone levels rather than natural pulsatile release. Best for those wanting steady GH elevation with minimal injection frequency.

Who Should Consider CJC-1295 (DAC)

  • Adults over 30 with age-related GH decline (somatopause) seeking sustained GH support
  • Athletes and bodybuilders wanting steady GH elevation with minimal injection frequency
  • Adults seeking improved body composition with once-weekly dosing convenience
  • Individuals with poor sleep quality and slow recovery between training sessions
  • Post-injury patients wanting prolonged GH-mediated tissue repair

How CJC-1295 (DAC) Works

CJC-1295 with DAC binds to the GHRH receptor on pituitary somatotroph cells to stimulate growth hormone release. The Drug Affinity Complex (DAC) contains a reactive maleimido group that forms a covalent bond with Cys34 on circulating serum albumin after injection. This bioconjugation shields the peptide from enzymatic degradation and renal clearance, extending its half-life from minutes to approximately 8 days. The result is sustained, non-pulsatile GH elevation and prolonged IGF-1 increases lasting 9-11 days after a single dose.

What to Expect

Week 1-2

Improved sleep quality and mild water retention as GH and IGF-1 levels rise. Sustained GH elevation begins within hours of first injection.

Weeks 3-4

Recovery between training sessions improves. Skin hydration and quality begin to improve. Energy and mood stabilize.

Months 2-3

Visible body composition changes — reduced abdominal fat, improved muscle fullness. Joint and connective tissue recovery accelerates.

Months 3-4

Peak anti-aging and body composition benefits. Sustained fat loss with preserved lean mass. Hair and nail growth may accelerate.

Month 5+

Benefits plateau. Cycle off for 4 weeks to restore pituitary sensitivity before restarting.

Dosing Protocol

LevelDose / InjectionFrequency
Beginner1mgWeekly
Moderate2mgWeekly
Aggressive2mg2x/week

Note: Long-acting GHRH analog with Drug Affinity Complex. Sustained GH elevation. Once-weekly dosing.

How to Inject CJC-1295 (DAC)

Inject subcutaneously once or twice weekly. Timing relative to meals is less critical than with short-acting GHRH analogs due to sustained release. Rotate injection sites between abdomen, thigh, and upper arm. Evening dosing may complement natural nocturnal GH secretion.

Cycling Protocol

On Period
12 weeks
Off Period
4 weeks

Cycle to maintain pituitary sensitivity. The long half-life means steady-state is reached after 2-3 injections.

Pharmacokinetics

Half-Life
192h
Bioavailability
SC: estimated 90%+ due to albumin binding preventing degradation
Tmax
2-4 hours (GH peak after SC injection)
Data Confidence
moderate

Source: Estimated t½ 5.8-8.1 days via albumin bioconjugation (Teichman et al. 2006 PMID 16352683)

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

Water retention, tingling/numbness in extremities, joint pain. May cause sustained GH elevation that doesn't mimic natural pulsatile release.

Contraindications

  • Active cancer or history of malignancy — sustained GH elevation promotes cell proliferation
  • Diabetes mellitus — prolonged GH release antagonizes insulin and may worsen glycemic control
  • Pregnancy or breastfeeding
  • Active pituitary tumors or other intracranial neoplasms
  • Hypersensitivity to GHRH analogs or any component of the formulation
  • Acute critical illness — elevated GH during critical illness is associated with increased mortality

Drug Interactions

  • Insulin and oral hypoglycemics — sustained GH release antagonizes insulin action; frequent blood glucose monitoring required
  • Corticosteroids — chronic use blunts GH response and counteracts anabolic benefits
  • Other GH secretagogues (GHRP-2, GHRP-6, sermorelin) — additive GH release increases side effect risk; avoid stacking without medical supervision
  • Thyroid hormones — GH accelerates T4-to-T3 conversion; monitor thyroid function during use
  • Anticoagulants (warfarin, heparin) — albumin binding may theoretically alter drug displacement; monitor INR
  • CYP450-metabolized drugs — GH may alter hepatic clearance of CYP3A4 substrates

Storage & Stability

Before Reconstitution
Refrigerate at 2-8°C, stable up to 12 months
After Reconstitution
Refrigerate, use within 4 weeks
Temperature
2-8°C (36-46°F)

Molecular Profile

Amino Acids
30
Molecular Weight
3,647.25 Da
Sequence
YDADIFTQSYRKVLAQLSARKLLQDILSRK
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Prolonged Stimulation of GH and IGF-I Secretion by CJC-1295 in Healthy AdultsPubMed 16352683
  2. Pulsatile Secretion of GH Persists During Continuous Stimulation by CJC-1295PubMed 17018654
  3. hGRF(1-29)-Albumin Bioconjugates Activate the GRF Receptor: Identification of CJC-1295PubMed 15817669
  4. Once-Daily CJC-1295 Normalizes Growth in the GHRH Knockout MousePubMed 16822960
  5. Activation of the GH/IGF-1 Axis by CJC-1295 Results in Serum Protein Profile ChangesPubMed 19386527

Frequently Asked Questions