Peptide Schedule
Calcitonin (Miacalcin)32 residuesCSNLSTCVLGKLSQELHKLQTYPRTNTGSGTPEach bubble = one amino acid. Size = residue mass. Color = chemical class.

Calcitonin (Miacalcin)

Healing & RecoveryInjection/NasalFDA ApprovedGrade B~1 hour (58-64 minutes) half-life
Bone HealthOsteoporosisPaget DiseaseFDA-ApprovedAnti-ResorptiveHypercalcemia12 weeks on / 4 weeks off

Benefits

Inhibits osteoclast-mediated bone resorption, preserving bone mineral density (PROOF Study, PMID: 10996576)
Reduces risk of new vertebral fractures by 33% at 200 IU daily in postmenopausal osteoporosis (PROOF Study)
Provides analgesic relief from acute bone pain in vertebral fractures and Paget disease
Rapidly lowers serum calcium in hypercalcemic emergencies within 2-6 hours of administration
Reduces elevated serum alkaline phosphatase and urinary hydroxyproline in Paget disease
Increases lumbar spine BMD by up to 7% in idiopathic male osteoporosis (PMID: 11874243)
Well-established safety profile with over 50 years of clinical use since FDA approval in 1975
Half-Life
~1 hour
Route
Injection / Nasal
Frequency
Daily
Vial Sizes
0.5IU, 1IU
BAC Water
Pre-filled
Safety Grade
Grade B
Open Calcitonin (Miacalcin) Dosage Calculator
Calculate exact syringe units for your vial and dose

About Calcitonin (Miacalcin)

Calcitonin is a 32-amino-acid peptide hormone naturally produced by the parafollicular C-cells of the thyroid gland. The synthetic salmon form (calcitonin-salmon) used in Miacalcin and Fortical is approximately 40-50 times more potent than human calcitonin on a weight basis and has a longer duration of action, making it the preferred therapeutic variant. First approved by the FDA in 1975, calcitonin-salmon is indicated for the treatment of postmenopausal osteoporosis in women more than 5 years post-menopause, symptomatic Paget disease of bone, and hypercalcemic emergencies. The peptide works by directly binding to calcitonin receptors on osteoclasts, the cells responsible for breaking down bone tissue. This binding inhibits osteoclast-mediated bone resorption, slowing the rate at which calcium is released from bone into the bloodstream. In Paget disease, where bone turnover is pathologically accelerated, calcitonin reduces the elevated levels of serum alkaline phosphatase and urinary hydroxyproline, clinical markers of excessive bone remodeling. For osteoporosis, calcitonin helps preserve bone mineral density and has been shown to reduce the risk of new vertebral fractures. Beyond its skeletal effects, calcitonin also possesses notable analgesic properties for bone pain, which is particularly beneficial in acute vertebral fractures and Paget disease. The exact mechanism of this analgesic effect is not fully understood but may involve central endorphin-mediated pathways and direct modulation of pain-related neuropeptides. While bisphosphonates have largely supplanted calcitonin as first-line therapy for most bone disorders, calcitonin remains a valuable option for patients who cannot tolerate bisphosphonates, require rapid reduction of serum calcium, or need acute bone pain relief.

Who Should Consider Calcitonin (Miacalcin)

  • Postmenopausal women with osteoporosis (>5 years post-menopause)
  • Patients with symptomatic Paget disease of bone
  • Patients with hypercalcemic emergencies requiring rapid calcium reduction
  • Patients who cannot tolerate bisphosphonates or have contraindications to them
  • Individuals with acute vertebral fracture pain requiring analgesic bone therapy

How Calcitonin (Miacalcin) Works

Calcitonin-salmon exerts its effects primarily by binding to the calcitonin receptor (CTR), a G protein-coupled receptor predominantly expressed on osteoclasts. Upon receptor binding, calcitonin activates adenylate cyclase, increasing intracellular cyclic AMP (cAMP) levels, and simultaneously stimulates phospholipase C, raising intracellular calcium concentrations. These signaling cascades cause rapid morphological changes in osteoclasts: the cells lose their ruffled border (the resorptive surface), retract from the bone surface, and cease secretion of acid and proteolytic enzymes such as cathepsin K and tartrate-resistant acid phosphatase (TRAP). This effectively halts bone resorption within minutes of administration. In the kidneys, calcitonin acts on distal tubular cells to increase urinary excretion of calcium, sodium, and phosphate, contributing to the rapid lowering of serum calcium in hypercalcemia. Calcitonin also appears to modulate pain signaling through several proposed mechanisms: stimulation of beta-endorphin release, inhibition of prostaglandin synthesis in bone, and direct action on serotonergic pathways in the central nervous system. With chronic exposure, osteoclasts may downregulate CTR expression (receptor escape), which accounts for the tolerance phenomenon observed in some patients after prolonged therapy. Salmon calcitonin differs from human calcitonin at 16 of 32 amino acid positions, contributing to its greater receptor binding affinity and resistance to enzymatic degradation.

What to Expect

Hours 2-6

Serum calcium begins to decline in hypercalcemic patients; analgesic effects may be noticed

Weeks 2-4

Reduction in bone pain from Paget disease; decreased biochemical markers of bone turnover

Months 1-3

Measurable decreases in serum alkaline phosphatase and urinary hydroxyproline in Paget disease

Months 6-12

Stabilization or modest increase in bone mineral density at lumbar spine

Year 1-3

Sustained fracture risk reduction with continued therapy; tolerance monitoring recommended

Dosing Protocol

LevelDose / InjectionFrequency
Beginner50 IUDaily
Moderate100 IUDaily
Aggressive200 IUDaily

Note: Calcitonin-salmon is available as a subcutaneous/intramuscular injection (Miacalcin) and a nasal spray (Fortical/Miacalcin Nasal). The injectable form delivers 200 IU/mL in pre-filled vials; typical therapeutic dose is 100 IU daily for both Paget disease and osteoporosis. For hypercalcemia, initial dosing is 4 IU/kg every 12 hours. Injection-site rotation is important to minimize local reactions. Flushing of face and hands may occur minutes after injection and usually resolves within an hour. Adequate calcium and vitamin D supplementation is essential during therapy. Serum calcium should be monitored periodically, especially early in treatment. A skin test is recommended before the first dose due to potential for allergic reactions. Tolerance can develop over months; if biochemical or clinical relapse occurs, dosage increases or temporary discontinuation may be considered. Store unopened vials refrigerated at 2-8 degrees C.

How to Inject Calcitonin (Miacalcin)

For subcutaneous injection, the standard dose is 100 IU (0.5 mL) administered once daily, preferably in the evening to minimize nausea. Rotate injection sites between the abdomen, outer thigh, and upper arm. Perform a skin test before the first dose: inject 0.1 mL of a 10 IU/mL dilution intracutaneously on the inner forearm and observe for 15 minutes for wheal or erythema. For hypercalcemia, the initial dose is 4 IU/kg every 12 hours via subcutaneous or intramuscular route, which can be increased to 8 IU/kg every 12 hours if response is inadequate after 1-2 days. Allow refrigerated medication to reach room temperature before injection to reduce discomfort. Monitor serum calcium, alkaline phosphatase, and 24-hour urinary hydroxyproline periodically. Ensure adequate calcium (at least 1000 mg/day) and vitamin D (400 IU/day) supplementation throughout treatment.

Cycling Protocol

On Period
12 weeks
Off Period
4 weeks

Continuous daily use is standard for osteoporosis and Paget disease as prescribed. Cycling or intermittent dosing (e.g., alternating months) may be considered to mitigate antibody-mediated tolerance that can develop with prolonged therapy. Consult prescribing physician for individualized cycling decisions.

Pharmacokinetics

Half-Life
1h
Bioavailability
66-71% (IM/SC injection)
Tmax
~23 minutes (subcutaneous)
Data Confidence
high

Source: FDA Miacalcin label: 58-64 minutes IM/SC (PMID: 30725954)

Pharmacokinetics — Active Dose Over Time

Loading the interactive decay curve.

Side Effects

The most common side effects of injectable calcitonin-salmon include nausea (occurring in approximately 10% of patients), facial flushing of the face, hands, and feet (2-5% of patients), and injection site reactions such as redness, swelling, or pain. Gastrointestinal effects may include diarrhea, abdominal discomfort, and decreased appetite. Flushing typically occurs within minutes of injection and resolves within an hour. Less common effects include urinary frequency, headache, dizziness, and tingling of the hands or feet. Hypocalcemia is a pharmacological risk that may manifest as muscle cramps, tetany, or paresthesias, particularly early in treatment. Rare but serious allergic reactions including anaphylaxis have been reported; a skin test is recommended before initial use. Long-term use may lead to antibody formation and development of tolerance, reducing therapeutic efficacy. A meta-analysis of clinical trials noted a small increased incidence of malignancy in calcitonin-treated patients compared to placebo, prompting regulatory review. The nasal spray formulation has a milder side-effect profile but may cause rhinitis, nasal irritation, epistaxis, and sinusitis.

Contraindications

  • Known hypersensitivity or allergy to calcitonin-salmon or any formulation component
  • Pre-existing hypocalcemia (must correct calcium levels before initiating therapy)
  • Clinical allergy to salmon or fish proteins (potential cross-reactivity)
  • Pregnancy and lactation (limited safety data; not recommended)

Drug Interactions

  • Lithium: calcitonin may increase renal lithium clearance, reducing lithium plasma levels; monitor lithium levels closely
  • Bisphosphonates (alendronate, zoledronic acid): concurrent use not recommended due to redundant bone resorption inhibition and risk of over-suppression of bone turnover
  • Cardiac glycosides (digoxin): calcitonin-induced hypocalcemia may alter sensitivity to digitalis; monitor calcium and digoxin levels
  • Etelcalcetide and other calcimimetics: additive risk of hypocalcemia when used concurrently

Storage & Stability

Before Reconstitution
Store unopened vials refrigerated at 2-8 degrees C; protect from light
After Reconstitution
Pre-filled solution; once opened, store at 2-8 degrees C and use within 14 days
Temperature
2-8 degrees C (36-46 degrees F); do not freeze

Molecular Profile

Amino Acids
32
Structure
Cyclic
Sequence
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
HydrophobicPolarPositiveNegativeSpecialHow we generate these icons

Related Peptides

References

  1. Calcitonin - StatPearlsReview
  2. PROOF Study: Nasal spray salmon calcitonin reduces vertebral fracture risk in postmenopausal osteoporosisClinical Trial
  3. Randomized trial of nasal spray salmon calcitonin in men with idiopathic osteoporosis: effects on BMD and bone markersClinical Trial
  4. Miacalcin (calcitonin-salmon) injection FDA prescribing informationFDA Label
  5. Calcitonin: A useful old friendReview

Frequently Asked Questions